Vb.net report generator punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Our AI voice agent is designed to transform your business's approach to lead generation, customer service follow-ups, confirmation calls, and appointment setting. We offer custom development of voice-based agents that can conduct conversations as naturally as a It Works:Consultation & Requirement Analysis: We start with a phone consultation to grasp your business needs, customer demographics, and specific scenarios for the voice Agent Development: Our team develops an AI voice agent tailored to your business, ensuring the voice agent can manage a wide range of inquiries with human-like comprehension and & Deployment: The AI voice agent is seamlessly integrated into your current systems and set up to make outbound Features:Scalable outreach with 24/7 AvailabilityCustom Voic...
...PROVINCE 77000 THAILAND • Has a camera or phone/tablet of quality with a camera, internet access • Must be available during business hours (9 AM - 4 PM) on working days Please see the attached file for the site visit guidelines. You are only required to deliver the pictures, video & observations and are not expected to assemble a report like the Sample Report. Note: Milestone will be released the following week after the site visit to give us time to organize the report and contact you if we need additional clarification....
...company's management and operational practices is also required. Legal Documents for Review: - Corporate Governance Documents: A thorough review of the company's corporate governance documents is necessary. - Litigation and Dispute Records: I need an analysis of the company's litigation and dispute records. Reporting: - I require a detailed analysis with recommendations: The final due diligence report should include a comprehensive assessment of the findings with actionable recommendations. Ideal Skills and Experience: - Extensive legal background, particularly in corporate law and regulatory compliance - Proven experience conducting due diligence on publicly traded companies - Excellent analytical skills - Ability to provide practical recommendations based on f...
I am currently facing some errors in my Angular frontend that's part of a .NET Web API project. Key Responsibilities: - Troubleshoot and debug existing Angular components - Identify and fix issues with data binding, component creation and form validation Ideal Skills: - Proficient in Angular with experience in developing and debugging complex frontend applications - Familiarity with .NET Web API - Experience with NgRx for state management Please note, the goal is to get my frontend running smoothly and effectively communicating with the backend.
...descriptions. Ensure all sections of the GMB profile are complete and professional. Requirements: Experience with Google My Business setup and optimization. Strong research skills, particularly using Google Maps. Knowledge of local SEO best practices. Ability to deliver daily research reports and handle GMB setup tasks promptly. Excellent communication skills and attention to detail. Deliverables: Daily Report with 20–30 researched businesses, including key details and GMB optimization gaps. Fully optimized Google Business Profiles for clients, completed within agreed timelines. Budget: Monthly Budget: $300 (approximately $10/day for research and profile setup). Rate structure: Open to hourly or project-based payments within this budget....
...transformation strategy Technology stack optimization Performance optimization and scalability solutions Industry Solutions Enterprise Resource Planning (ERP) systems Customer Relationship Management (CRM) solutions Business Intelligence and Analytics platforms Workflow automation systems Our Technical Expertise Frontend: React.js, Angular, Vue.js, HTML5/CSS3 Backend: Java, Python, Node.js, .NET Mobile: iOS (Swift), Android (Kotlin), React Native Database: SQL, NoSQL, MongoDB, PostgreSQL Cloud: AWS, Azure, Google Cloud DevOps: Docker, Kubernetes, Jenkins Our Development Approach Agile methodology with iterative development Regular client communication and progress updates Comprehensive testing and quality assurance Post-deployment support and maintenance Documentation and k...
I am looking for someone who can replicate and improve on ai generated content. You will be sent daily different kind of ai generated clips and your job is to replicate it with prompt, seed files, etc. You should then improve it. this is a part time job and we would start with 10-20 hours per week You should be someone who is always experimenting with a lot of different models, paid tools etc.
... --Respond to opportunities within the 12 AM - 2 PM PST timeframe, --Receive training on completing project forms and stay updated on new topics in IT consulting. --Schedule consulting jobs by reviewing Calendly availability, updating the project website with availability, and sending Outlook invites for confirmation. --Track and document responses to IT consulting project forms. --Monitor and report metrics related to the number of completed project forms, scheduled jobs, and other relevant data. --Update Consulting Profile with appropriate keywords. **Perform other assigned tasks as needed** Requirements: IT Consulting Virtual Assistant --General knowledge of IT applications, infrastructure, and security vendors or have experience with IT companies --Proficient in reading and...
I'm seeking a qualified pathologist or professional to assess autopsy photos concerning an important person. The aim is to prepare a statement for a press release and for research purposes. Your assessment will specifically focus on: - Injury evaluation The report will be intended for a general public audience, so clear, accessible language is crucial. Ideal skills and experience for the job: - Medical qualifications with a focus on pathology - Experience writing for a non-specialist audience - Ability to assess and interpret injury-related findings - Strong understanding of press release format and requirements
I'm in need of a soft copy of the circuit/wiring diagram for the Carestream DRX Evolution X-Ray. The diagram should be in PDF format and detail the connections from the X-ray console to the generator, the chest bulky, and the tube head with moderate detail, including key connections. Simply put, I'm looking for: - A PDF circuit/wiring diagram for the Carestream DRX Evolution X-Ray - Diagram detailing key connections to specific components - Moderate detail level with key connections If you have access to this document, I'm happy to pay for it. Please get in touch. Thank you.
I'm seeking a proactive lead generator and appointment setter for my website design agency, specifically targeting small businesses via social media. Key Responsibilities: - Identify and engage with small business owners on social media platforms - Generate leads and set appointments for website design consultations Ideal Skills and Experience: - Proven experience in lead generation and appointment setting - Proficiency in using various social media platforms for business purposes - Excellent communication and interpersonal skills - Familiarity with website design industry is a plus
I'm looking for a C# plugin for Power BI Desktop that can help me optimize my reports. The plugin should: - Detect unused columns in tables and create M queries to remove them. - Scan all open Power BI reports and list them in a combo box for selection. - Identify all measures in the selected report and provide optimized DAX code for each. A list of these measures should also be in a combo box. My primary data sources are SQL DB and Excel, so experience with these is crucial. The plugin needs to work with both imported data and DirectQuery modes.
...Development Specialist to help us acquire freelancing projects in web development. Your role will include finding and bidding on projects, communicating with clients, and closing deals on platforms like Upwork, Freelancer, Fiverr, and Bark. Responsibilities: Identify and bid on relevant projects. Communicate with clients to understand their needs. Create winning proposals and close deals. Report progress regularly. Skills Needed: Experience with freelancing platforms (Upwork, Fiverr, etc.). Strong communication and negotiation skills. Familiarity with web development services (especially WordPress). Compensation: This is a commission-based role: 10%-20% of the project value, depending on the size of the deal. Performance bonuses for hitting targets. If you’r...
I'm looking for an expert in electrical engineering and MATLAB/Simulink to derive the mathematical model of a 2-pole, 3-phase, 50 Hz, 11 kV Synchronous Generator (SG) in the dq-reference frame using Park’s transformation, starting from its stator and rotor voltage equations. Key Requirements: - The model should specifically include transient dynamics. - Both the stator and rotor need to be modeled in the dq-reference frame. - The model should be able to simulate fault conditions. Ideal Skills: - Strong background in electrical engineering, specifically in synchronous generators. - Proficient in MATLAB/Simulink. - Experience with modeling in the dq-reference frame and using Park’s transformation.
I am looking for a comprehensive SEO specialist to enhance my e-commerce site's visibility on in light of the new November 2024 EAT update. Key Responsibilities: - Implement on-page, off-page, and technical SEO strategies to improve search engine rankings. - Focus on content quality, backlinks, and page speed as primary ranking factors. - Regularly monitor and report on progress, adjusting strategies as necessary to ensure continual improvement. Ideal Skills: - Expertise in all areas of SEO. - Proven experience with e-commerce sites. - Up-to-date knowledge of Google’s ranking factors and algorithm changes. - Excellent understanding of content quality, backlinking strategies, and page speed optimization. Please note that my primary objective for this project is to imp...
I'm looking for a designer to enhance the top navigation bar of our website. Look at the picture. JUST THE TOP NAV BAR ONLY. The current design isn't visually appealing enough and the readability could be improved. Key Tasks: - Refresh our existing Market Movers Report logo. This should be a slight update, using the same colours as the original logo. - Enhance the top navigation bar. This should incorporate a more appealing visual design and improved readability, while still aligning with the overall design of our homepage. Requirements: - Use the same colours and fonts as the rest of our homepage. - Design with a 'sleek and modern' aesthetic in mind. The refreshed logo should be purely text-based without any icons or symbols. Skills and experience ideal fo...
I need an expert to help set up my Asana for managing consulting projects. Key aspects of the setup will include: - Creating projects and tasks specifically tailored to consulting - Designing project templates for efficiency - Setting up tasks for client onboarding and management - Scheduling and appointment setting - Report generation and reviews The ideal candidate should have significant experience with Asana, particularly in setting up projects and tasks. Experience in the consulting field would be an advantage. Excellent organizational skills and attention to detail are essential.
...service. - Lead Analysis: Ensure leads align with my service and have high conversion potential. - Sales Strategy: Develop a strategy to convert these leads into paying clients. - Lead Nurturing: Engage leads to build trust and encourage conversions. - Sales Closing: Close at least 2 confirmed sales from these leads. Budget: $10 (fixed price). Timeline: 1 month. Deliverables: - Niche Research Report: 20 leads with verified contact details, company name, job title, and a brief problem overview. - Sales Confirmation: 2 confirmed sales through these leads, verified via Fiverr order details. More details: - Is this project for business or personal use? Starting gig on Fiverr - What information should successful freelancers include in their application? Detailed project pro...
I'm looking for a robust string generator that can create strings based on specific rules. The strings will primarily be composed of alphanumeric characters and three basic arithmetic operators. Their length will vary, being a minimum of 4 characters and a maximum of 6. Key requirements: - The output should be in plain text. - The strings need to undergo several validations: length validation, character set validation, and pattern matching validation. - The patterns do not need to follow a predictable sequence, but there will be multiple possible values in terms of length. Ideal skills for this project include experience in string manipulation and data generation, with strong attention to detail for the required validations.
Project Objective: Write a short report (500–800 words) analyzing a chosen political movement (Nationalism, Globalism, Religious Traditionalism, or Progressive Activism). Project Structure 1. Title Choose one movement to focus on and create a title for your report. Example: “The Role of Nationalism in Contemporary Politics” or “Globalism: Connecting Nations to Address Climate Change.” 2. Introduction (100–150 words) • Define your chosen political movement. • Briefly explain why this movement is important in the modern world. • Cite your chosen case study or example. Example: Nationalism is a political movement that emphasizes the importance of national sovereignty and cultural identity. In recent years, movements such as Brex...
I'm in need of a seasoned social media marketer with a special focus on TikTok. The primary aim is to enhance our brand visibility on this platform. Key Responsibilities: - Strategize and implement engaging TikTok content aimed at increasing our brand awareness. - Monitor, analyze and report on campaign performance. Ideal Candidate: - Proven experience in social media marketing, particularly on TikTok. - Creative mindset with ability to generate engaging content. - Proficient in data analysis and performance tracking.
...candidate should have expertise in creating, editing, and debugging Google Apps Scripts to streamline data handling, calculations, and report generation. Requirements: Proven experience with Google Apps Script for Excel/Google Sheets automation. Ability to create custom scripts to automate repetitive tasks, manage data, and enhance productivity. Knowledge of integrating third-party APIs (if needed) with Google Sheets. Strong problem-solving and debugging skills. Effective communication and ability to meet deadlines. Scope of Work: Analyze the current Excel workflow and identify automation opportunities. Develop scripts to automate data entry, formatting, and report generation. Ensure error handling and smooth functionality of the automation. Provide documentati...
I am currently facing some errors in my Angular frontend that's part of a .NET Web API project. Key Responsibilities: - Troubleshoot and debug existing Angular components - Identify and fix issues with data binding, component creation and form validation Ideal Skills: - Proficient in Angular with experience in developing and debugging complex frontend applications - Familiarity with .NET Web API - Experience with NgRx for state management Please note, the goal is to get my frontend running smoothly and effectively communicating with the backend.
I am currently facing some errors in my Angular frontend that's part of a .NET Web API project. Key Responsibilities: - Troubleshoot and debug existing Angular components - Identify and fix issues with data binding, component creation and form validation Ideal Skills: - Proficient in Angular with experience in developing and debugging complex frontend applications - Familiarity with .NET Web API - Experience with NgRx for state management Please note, the goal is to get my frontend running smoothly and effectively communicating with the backend.
I am currently facing some errors in my Angular frontend that's part of a .NET Web API project. Key Responsibilities: - Troubleshoot and debug existing Angular components - Identify and fix issues with data binding, component creation and form validation Ideal Skills: - Proficient in Angular with experience in developing and debugging complex frontend applications - Familiarity with .NET Web API - Experience with NgRx for state management Please note, the goal is to get my frontend running smoothly and effectively communicating with the backend.
I'm looking for an expert in process automation to streamline report generation and approval workflows in my company. The goal is to have these processes automated on a daily basis using data sourced from Google Sheets. Ideal Skills and Experience: - Proficiency in Google Forms and Google Sheets - Strong experience in process automation - Ability to set up daily automated workflows - Knowledge of report generation automation - Familiarity with approval workflows automation Automation of below Live Feeds from My team in forms to sheets: -Lead generation -Contact details -Dispatch advises -Conversion advise -Reservation -Lpo request -Expense report -Visit report -physical inward -Physical outward -LR tracking -TC request
I am seeking a professional with a solid understanding of community development and environmental analysis to write a concise report evaluating the environmental impact of waste management at community festivals. The report should investigate how waste is managed during these events and its subsequent influence on the environment. Ideal skills and experience: - Expertise in environmental impact analysis, particularly in relation to waste management - Strong background in community development - Proficient in event analysis - Exceptional report writing skills
A company is on a growth trajectory in the electric scooter sector, and we need a detailed financial model to guide our expansion plan. Key Responsibilities: - Create a comprehensive financial model that includes: - Capital expenditure requirements primarily focused on the expansion of our existing facilities - Projections of our Net Present Value (NPV) for evaluating the expected return on investment - A detailed break-even analysis - Provide thorough explanations for each component of the model - Meet a tight timeline for delivery Ideal Skills and Experience: - Proficient in financial modeling with a focus on capital expenditure and investment return evaluation - Strong understanding of the electric vehicle market and production scaling - Ability to deliver high-quality wo...
...web platform for detecting plagiarism and AI-generated content in scientific papers. The platform should support PDF files up to 600 pages and generate a detailed report that includes: Plagiarism Detection: The platform must analyze the text and content of the document to identify and calculate the percentage of plagiarism compared to various online sources or specific databases. AI-Generated Content Detection: The platform should also be able to identify sections of the document that are likely to have been generated by artificial intelligence, providing a percentage of AI-generated content. Location Identification: The report should pinpoint the exact sections where plagiarism or AI content is detected, along with links or references for verification. Technical Requirem...
I have completed the work as requested. Here is a summary of what I have done: I tested the "GPSLocationTracker" app as requested, providing detailed feedback on the user interface, functionality, and suggesting some improvements. I also highlighted the main bugs I encountered, as mentioned in my previous communication. I’ve prepared a text file with a full report of the tests, including all the issues I found and suggested solutions. Everything has been done according to your instructions, so I kindly ask you to confirm if the work meets your expectations. If there is anything to adjust, please let me know. Once you confirm, I will be ready to proceed with closing the project. Thank you for your cooperation!
...seeking a professional to develop comprehensive project documentation for MSMEs. The documentation should encompass: - A detailed Business Plan - An exhaustive Financial Report - A practical Operational Manual The Business Plan should specifically include: - A well-structured Marketing Strategy - An insightful Executive Summary In the Marketing Strategy, a particular emphasis should be placed on: - A thorough Competitive Analysis Ideal skills and experience for this job include: - Proven track record in business plan development, particularly for MSMEs - Strong financial acumen for creating an impactful Financial Report - Excellent operational understanding for drafting the Operational Manual - Experience in conducting and presenting a competitive analysis - Highly s...
...Instagram and Facebook, with a focus on creating promotional content. This will involve creating engaging posts and dynamic reels that are consistent with our brand identity. Key Responsibilities: - Develop and implement a social media strategy - Create engaging, promotional content for Instagram and Facebook - Help define and establish our brand identity on social media - Monitor, analyze and report on social media performance Ideal Skills: - Proven experience as a Social Media Manager - Exceptional content creation skills - Strong understanding of Instagram and Facebook algorithms - Ability to work independently and take initiative Experience with brand development is a plus. I'm excited to work with a creative professional who can help us connect with our audience and...
...Users - Inventory - Requests - Notifications - Locations - Activity Logs 2. **Features:** - Data validation - Indexing optimization - Security rules - Backup systems ## Enhanced Features for Web Version ### 1. Advanced Dashboard - Customizable widgets - Advanced analytics - Export capabilities - Bulk operations - Real-time monitoring ### 2. Enhanced Reporting - Custom report builder - Multiple export formats - Scheduled reports - Interactive charts - Data drilling ### 3. Batch Operations - Bulk inventory updates - Mass request processing - Multiple item selection - Batch status changes - Bulk notifications ### 4. Advanced Search - Filters and sorting - Global search - Advanced filtering - Saved searches - Search history ### 5. Integration Capabil...
...Support: Develop and execute a social media PR strategy to drive excitement before and after the release. Influencer Collaborations: Identify and collaborate with influencers in the music and entertainment industry to promote the video. Event Planning: If required, organize a virtual or in-person launch event to showcase the video to the press and fans. Monitoring Coverage: Track media coverage, report results, and suggest improvements for future campaigns. Crisis Management: Handle any negative PR and respond to public or media queries professionally. Requirements: Proven experience in music PR or entertainment PR campaigns. Strong network of media contacts in the music and entertainment industry. Excellent written and verbal communication skills in Hindi and English. Creative t...
I'm seeking a comprehensive report assessing the potential for trademarking my company's name and logo in the USA. While I've conducted basic searches, I need an expert's evaluation. Key areas to investigate: - Availability of the trademark for specific goods my company produces - Potential risks or challenges in the trademark application process - Recommendations for next steps Ideal candidates should have: - Extensive experience in intellectual property law, particularly trademarks - Strong research and analytical skills - Ability to provide clear, concise reports
...reports. c) Other standard business correspondence. • The assistant should be able to understand my verbal/text input for email requirements and draft professional responses accordingly. 5. Daily Dashboard Automation • Consolidate data from Smartsheet into a daily dashboard emailed to me and my team leads. • Include progress updates, order status, team performance, and KPIs. • Schedule the report to send automatically every morning. 6. Outlook Email Organization and Suggested Replies • Integrate with Microsoft Outlook to: a) Categorize and prioritize emails automatically. b) Suggest responses using context from previous emails, attachments, and Smartsheet data. c) Allow me to review and approve AI-drafted replies. 7. Meeting Summaries and Insights...
...timeliness and quality of partners’ performance of obligations. ? Our Expectations: • Excellent communication skills and the ability to quickly establish contact; • Ability to write clear and professional correspondence in Spanish and English; • Proficiency in English at a B1 level or higher (preferred). ? Conditions: • Work schedule: full-time (8 hours a day), 5/2; • Salary starting from 300 USD (net); • Friendly and positive team; • Opportunities for professional development and growth; • 2 weeks of paid vacation. ----------- Somos una empresa internacional de TI con más de 5 años de experiencia en el mercado. Actualmente estamos buscando un Especialista en Publicidad para atraer socios publicitarios a trav...
I'm seeking a professional to assess a parking lot for defects, specifically focusing on cracks and potholes. I would like this to be conducted using a drone survey. - Defect Identification: The main concern is to identify cracks and potholes in the parking lot. - Survey Method: A drone survey is preferred for this task. At this stage, I'm unsure whether I will require a detailed report with repair recommendations or just the identification of defects. Therefore, flexibility and adaptability will be key. Ideal candidates for this project should have: - Experience with drone surveys for defect identification - Knowledge in assessing parking lot conditions - Ability to provide detailed reports if needed - Good communication skills to discuss findings and recommendat...
I'm looking for a personal assistant who can help test out a tracker app purchase application. The primary focus will be on testing the app's functionality, specifically its navigation and layout. Key Responsibilities: - Test the app's functionality - Provide feedback on the user experience - Report any bugs and issues The ideal candidate for this project should: - Have experience in app testing - Be detail-oriented and able to identify issues that may not be immediately obvious - Be able to provide constructive feedback on the user experience Please note, testing will be conducted exclusively on a smartphone. Prior experience testing apps on a smartphone is highly desirable.
...- Develop and implement a comprehensive digital marketing strategy focused on promoting ESG and HKU Business School's programs. - Craft professional and engaging social media posts and advertisements tailored for LinkedIn and Instagram. - Boost posts strategically to maximize reach and engagement. - Ensure all messaging is in alignment with our ESG and academic objectives. - Monitor, track, and report on campaign performance with actionable insights. Ideal Candidate Profile: - Proven track record in digital marketing and social media management. - Familiarity with ESG and educational marketing is highly desirable. - Exceptional ability to create compelling content for LinkedIn and Instagram. - Strong understanding of our target audience and what resonates with them, with a ...
I'm in need of a skilled .NET developer who can help me automate interactions with a website using a web application. Key Responsibilities: - Implementing .NET technology to facilitate full automation of the website in the background while a web application inputs details. - Ensuring seamless interaction with the website's form submissions. Skills Required
...professional with proven experience in influencer outreach, specifically within the gaming industry. The main goal is to increase downloads of my strategy game on Android and PC platforms. Key Responsibilities: - Identify and reach out to potential gaming influencers who align with our brand and target audience. - Develop and execute an influencer marketing strategy aimed at boosting game downloads. - Report on engagement and conversion metrics from influencer collaborations. Ideal Skills and Experience: - Extensive network of gaming influencers, particularly on Android and PC platforms. - Proven track record in influencer marketing with measurable results. - Excellent communication and negotiation skills. - Strong understanding of the gaming community and market trends. Ple...
I'm looking for a seasoned professional with profound expertise in Google ...expertise in Google Ads and Google Analytics GA4. The primary goal of my current Google Ads campaign is to generate leads. Key Responsibilities: - Optimize Google Ads campaigns geared towards lead generation - Create and set up custom audience segments in GA4 - Develop insightful reports from GA4 Ideal Skills: - Extensive experience with Google Ads - Proficient in Google Analytics GA4 - Excellent report writing skills - Capable of creating custom audience segments - Strong background in digital marketing and lead generation. I'm targeting someone who can understand and help refine our approach to lead generation through Google Ads, and assist with the configuration and interpretation of audie...
...DDoS and IP Spoofing detection tool. The primary focus of this tool will be on accurately identifying DDoS attacks. Key Features of the Tool: - Analyze both real-time and historical network traffic data. - Primarily detect volumetric DDoS attacks. - Utilize supervised learning methods through Splunk for detection. - Connect to our company's network via APIs. - Generate a comprehensive incident report that includes potential vulnerabilities identified. Ideal Candidates Should Have: - Proven experience in developing network security tools. - In-depth knowledge of DDoS and IP Spoofing attack patterns. - Proficiency in using Splunk for data analysis and supervised learning for anomaly detection. - Skills in API integration. Budget: $750 to $1250 max. Please share examples of...
I need a Microsoft ASP.NET Develop...the number of person on the Job Category showing in the chart. Microsoft Visual Studio Project & SQL Database backup attached, attached the Organization Chart Generated by this application. Key Tasks: - Adjust the layout of the chart to a vertical orientation. - Ensure the chart fits within a single page. -Click Event on Each Job Category Ideal Skills: - Proficiency in ASP.NET and Microsoft .NET Framework. - Expertise in graphical layouts and responsive designs, including jQuery. - Experience with SQL database integration for handling chart data. - Ability to deliver a quick and efficient solution. Most Important: - The chart should be responsive primarily for desktop computers. If you have the relevant expertise and can assist, please...
I'm seeking an SEO expert with a strong focus on off-page strategies. Your primary responsibility will be to build quality backlinks to our site, with the goal of driving significant traffic growth. Key Requirements: - Proven experience in SEO, particularly off-page strategies. - Expertise in creating high-quality backlinks. - Strong understanding of local SEO. - Ability to track and report on traffic growth. Your success in this role will be measured by the increase in traffic to our site, so I'm looking for someone who takes responsibility for their work and is committed to achieving results. Please note that I am not interested in a freelancer who simply creates 200-300 backlinks without aiming for quality or considering the impact on traffic growth.
