Vb.net create word document programmatically punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 vb.net create word document programmatically u gjetën punë
    Create a Design
    Ka përfunduar left

    I want to create a logo design

    €20 Average bid
    €20 Oferta mesatare
    45 ofertat
    create a macintosh
    Ka përfunduar left

    help me turn my laptop into a macintosh

    €34 Average bid
    €34 Oferta mesatare
    1 ofertat
    €16 Oferta mesatare
    12 ofertat
    €11 Oferta mesatare
    10 ofertat
    Programing
    Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11798 Average bid
    €11798 Oferta mesatare
    4 ofertat
    Crie um Website
    Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2865 Average bid
    €2865 Oferta mesatare
    1 ofertat
    qefqreqweqawdafsc
    Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €193 Average bid
    €193 Oferta mesatare
    1 ofertat
    Need PHP dev -- 3
    Ka përfunduar left

    PHP
    €35 Average bid
    €35 Oferta mesatare
    3 ofertat

    work now! Please mention if you worked on version 3 or 4 :) Need to modify our vendor's Admin & frontend according to attributes opencart expert only!!

    €10 - €29
    €10 - €29
    0 ofertat
    Need PHP dev -- 2
    Ka përfunduar left

    PHP
    €36 Average bid
    €36 Oferta mesatare
    9 ofertat
    Create a Wordpress Template
    Ka përfunduar left

    test porject test porject test porject test porject test porject test porject test porject test porject test porject

    €299 Average bid
    €299 Oferta mesatare
    2 ofertat
    Create a Mobile Website
    Ka përfunduar left

    Hudsv hjudfjb juddhjudd judsx jkgs

    €244 - €731
    €244 - €731
    0 ofertat
    yveguwvcjnjnecbkhb
    Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €110 Average bid
    €110 Oferta mesatare
    1 ofertat
    Trabajo en .NET -- 2
    6 ditë left
    Të verifikuara

    Elaborar interfaz de usuario enlazando componentes a base de datos, enlazar tablas a ComboBox, enlazar tablas al componente DataGridView, mostrar datos en TextBox.

    €6 / hr Average bid
    €6 / hr Oferta mesatare
    6 ofertat
    Create a Motion Graphic Animation
    6 ditë left
    Të verifikuara

    Before bidding, READ the attachment about working with us first! I am looking for a talented animator who can transform a static infographic (example attached) into a dynamic and engaging motion graphic animation. The goal is to make the steps visually appealing and easier to follow while maintaining a clean and professional style. Details: The animation will need to depict a step-by-step process, including elements like adding objects, pouring liquid, sealing a bag, waiting for a specified time, and showing the end result. It should be smooth, clear, and either visually similar to the provided design or presented with your own creative interpretation, as long as it effectively conveys the process. What I’m Looking For: Someone with proven experience in motion graphi...

    €39 Average bid
    €39 Oferta mesatare
    45 ofertat
    Full-Stack Developer for Next.js Site
    6 ditë left
    Të verifikuara

    I'm in need of a full-stack web developer to create a website using , React and Tailwind. As well as a backend api to inform the websites functionality. The full breakdown of the website is below: DO NOT contact me or give an offer until after reading the entire document.

    €1336 Average bid
    €1336 Oferta mesatare
    164 ofertat

    I'm looking for a talented video creator who can help me produce an educational YouTube video targeting the general public. The video should be designed to inform viewers on a particular topic in a casual and conversational tone. Key requirements: - Ability to simplify complex information for a general audience - Experience in creating casual and conversational style videos - Strong understanding of YouTube's video format and audience engagement strategies - Proficiency in video editing software and tools If you are skilled in creating engaging educational content and can deliver a high-quality video that meets these requirements, I would love to hear from you.

    €11 Average bid
    €11 Oferta mesatare
    13 ofertat

    I'm seeking a dedicated individual video and graphic editor capable of managing a high volume of work. Video Editing: - Comp... 700INR for videos exceeding 1 minute. - Majority of work: Editing social media clips. Social Media Graphic Design: - Platform: Primarily for Instagram. - Style: Minimalistic designs tailored for a variety of social media posts. Please note: - Only individual freelancers will be considered for this project, agencies need not apply. - For further project details, kindly refer to the attached document. Ideal skills for this project include: - Proficiency in video editing software. - Advanced skills in graphic design, particularly minimalistic styles. - Previous experience in editing social media content. - Understanding of Instagram's design requ...

    €210 Average bid
    €210 Oferta mesatare
    7 ofertat

    I need a freelancer to convert a 3-page PDF document into an Excel file. The Excel layout should mirror the PDF exactly. The PDF contains primarily text and numbers. Key Requirements: - Convert data from the PDF into Excel, maintaining the original layout. - Utilize your judgement to handle any ambiguities or potential errors in the PDF. Ideal skills for this job include: - Proficiency in Excel - Attention to detail - Ability to make educated guesses when faced with uncertainties in the source material.

    €59 Average bid
    €59 Oferta mesatare
    31 ofertat

    This project involves building an MVC + .NET 9 application for video streaming with the following features: Video Listing and Playback: List all videos available on the file server. Allow users to play any video of their choice using either Direct Streaming or WebRTC (configurable). Real-Time Notifications: Use SignalR to notify users whenever a new video is uploaded. Automatically play the newly uploaded video immediately after receiving the notification, using the configured streaming method (Direct Streaming or WebRTC). Audio Recording: If a user wants to speak, they can click the "Speak Now" button to: Pause video streaming. Open the microphone and start recording audio. Once recording is stopped, the audio file is uploaded and stored on the file server. Playback R...

    €167 Average bid
    €167 Oferta mesatare
    14 ofertat

    ...CONTACT)* Project Goal: To create a basic AI prototype that analyzes video footage from public spaces to identify potential security threats while minimizing privacy concerns. Project Scope: Phase 1: Research existing crowd monitoring technologies and privacy-preserving AI techniques (e.g., differential privacy, federated learning). Select a specific use case (e.g., identifying unusual crowd movements, detecting unattended objects). Gather and prepare a small dataset of publicly available video footage (e.g., from open-source repositories). Phase 2: Develop a simple AI model (using tools like TensorFlow or PyTorch) to analyze video frames and identify potential anomalies. Implement basic privacy-preserving techniques to minimize the risk of identifying individuals. Create...

    €145 Average bid
    €145 Oferta mesatare
    43 ofertat

    I'm looking for an expert who can help me create a comprehensive strategy for a lead generation campaign. The primary goal of the project is to generate leads and ultimately drive sales. Objectives - The main objective is to develop a strategy that is effective in reaching potential customers and converting them into leads. Target Audience - My target audience is quite diverse. It includes various age groups and genders, with a wide range of interests and behaviors. Additionally, they are located across different regions and hold various occupations. Tone & Style - The campaign should be professional yet approachable, striking a balance that appeals to a broad audience. Deliverables - A detailed strategy document outlining the campaign's different component...

    €11 / hr Average bid
    €11 / hr Oferta mesatare
    7 ofertat

    I'm in need of a professional translator who can convert Romanian legal documents into English. The specific document is a 'Certificat Constatator'. Key Requirements: - Expertise in legal document translation - Experience translating 'Certificat Constatator' - ONLY Certified translator Please note, the translation needs to be certified.

    €109 Average bid
    €109 Oferta mesatare
    21 ofertat

    Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.

    I cilësuar I vulosur Konkursi më i mirë MRS
    PDF Text & Image Editing Required
    6 ditë left
    Të verifikuara

    I require an expert in PDF editing services to help me rectify some errors in a document. The job will primarily entail: - Editing text and images in a PDF - Correcting typos and errors It's essential that throughout the editing process, the current format of the document is maintained. Therefore, experience with preserving document layout during edits is a key requirement for this project.

    €33 Average bid
    €33 Oferta mesatare
    109 ofertat

    I need help with a very simple C# Windows Forms application. I am completely stuck whenever I try to make this and need someone to help me complete this. The application requires the following features: - A user interface that is simple and minimal...3 for hours, the output should show 40 miles for hour 1, 80 miles for hour 2, and 120 miles for hour 3. The application also requires basic input validation to ensure the text boxes are not empty and contain numerical values. If the input is invalid, a message box should be displayed. Ideal skills and experience for the job include: - Proficiency in C# and .NET Framework - Experience with Windows Forms applications - Ability to create simple, user-friendly interfaces - Understanding of basic input validation and error handling...

    €58 Average bid
    €58 Oferta mesatare
    31 ofertat

    I am looking for a skilled developer to create a program that extracts text from Korean, Japanese, or Chinese comics and translates it using external AI services via APIs. This program will act as a bridge, utilizing existing AI tools for text recognition and translation. Key Features: Text Extraction: Extract text from comic files, including speech bubbles, captions, and annotations. Handle various formats such as scanned images, PDFs, and digital comics (e.g., PNG, JPG, WEBP, ePUB). Translation Integration: Use APIs from AI-based services (e.g., Google Translate, DeepL, OpenAI GPT) for translating the extracted text. Ensure seamless integration with third-party AI services. Supported Input Formats: Image files: PNG, JPG, WEBP. Document files: PDF, scanned images, DOC. ...

    €108 Average bid
    €108 Oferta mesatare
    12 ofertat

    I'm in need of a professional Arabic translator who specializes in legal document translation. The documents are in scanned image format, so expertise in handling such files is crucial. Skills and Experience: - Proficiency in Arabic and English, with a focus on legal terminology. - Experience in translating legal documents. - Able to work with scanned image files. - Strong attention to detail to ensure all translations are accurate and legally sound.

    €10 / hr Average bid
    €10 / hr Oferta mesatare
    33 ofertat
    .NET and Docker Debug Environment Setup
    6 ditë left
    Të verifikuara

    Get this sample code running and debugging in a Docker container using in VS Code and .NET 8, on my Mac. Will need a Docker files created which start up the .NET container and the RabbitMQ container. I may need a screenshare to help me get it up and running. I'm new to VS Code.

    €104 Average bid
    €104 Oferta mesatare
    5 ofertat
    .Net Grid with Telerik Controls
    6 ditë left
    Të verifikuara

    .Net application needs a new grid in one of the modules. See the attached file. Development is to be done on the local machine.

    €166 Average bid
    €166 Oferta mesatare
    10 ofertat

    I'm looking for someone skilled in Microsoft Word and PowerPoint to help design educational material aimed at students. The primary focus will be on formatting text and designing tables and charts. Ideal Skills and Experience: - Proficient in Microsoft Word and PowerPoint - Experience designing educational materials - Strong understanding of text formatting and style - Ability to create clear and engaging tables and charts - Attention to detail and ability to meet deadlines

    €2 / hr Average bid
    €2 / hr Oferta mesatare
    31 ofertat
    Google Forms to PDF Automation System
    6 ditë left
    Të verifikuara

    I'm looking for an experienced freelancer to design an automated system that captures data from Google Forms and generates a well-formatted PDF document. The project involves integrating Google Forms with a Google Sheet, cleaning and structuring the data, and creating a customizable PDF template. The primary goal of this automated system is to streamline the process of data collection and archiving. The system should be capable of: - Structuring the data from Google Forms into a Google Sheet with predefined headers and columns. - Performing essential data cleaning tasks, which include removing duplicates, standardizing formats (e.g., dates, text), and validating data entries. - Creating a customizable PDF template to present the data in a clear and professional manner. Ideal...

    €10 Average bid
    €10 Oferta mesatare
    29 ofertat
    Trophy icon New Logo Design
    2 ditë left

    ...Here's a description of a professional, impactful logo design: Logo Elements Typography: Use modern, sans-serif fonts to convey innovation and professionalism. Highlight "CallCatch" in bold or slightly larger font, with "AI" in a futuristic, tech-inspired style to emphasize the AI aspect. Icon: A sleek phone symbol or a missed call notification icon to represent calls. Incorporate an abstract "net" or "catching" element, such as a swoosh or loop, to symbolize capturing leads. Include subtle AI-related imagery, like a circuit board pattern, a small brain icon, or digital waves, integrated into the phone or catching element. Color Palette: Blue and green tones to evoke trust, technology, and growth. Accent colors like orange or yello...

    €10 Average bid
    I garantuar
    €10
    173 kandidaturat

    I require a professional with experience in PDF editing and interactive design to modify a PDF document for me. The task involves the following: - Integrating 15-20 dropdown boxes into the PDF. - All dropdown boxes should allow the user to select multiple items. The content of the dropdowns will be purely text. Therefore, I am looking for someone with keen attention to detail to ensure the text is accurate and well presented. Ideal skills and experience for the job: - Proficiency in PDF editing software - Experience in creating interactive PDF documents - High attention to detail - Excellent text handling skills I need some of the boxes to have the ability to enter text with each selection.

    €367 Average bid
    Urgjent
    €367 Oferta mesatare
    92 ofertat

    I am looking for a talented Graphic designer for an upcoming project. Ideal skills and experience for the job: - Graphic Design - Adobe Creative Suite

    €89 Average bid
    €89 Oferta mesatare
    67 ofertat

    I'm looking for a Python developer who can create a script for me. The script should: - Take a Wayback Machine page url as input - For each feature listed on (), determine if the feature is implemented on the Wayback Machine page by analyzing the page's HTML, CSS, and inline JavaScript. Make sure to exclude code injected by the Internet Archive. - Support all versions of all major browsers. - Output the feature compatibility list as a CSV file with four columns: wayback machine page root url, browser name, browser version, feature implemented yes/no. The freelancer should also provide a short document (1-3 pages) detailing how the script works. The ideal freelancer for this project should have extensive experience in Python

    €119 Average bid
    €119
    17 kandidaturat

    Only Genuine Exp devlopers bid for this project: The candidate will be responsible for creating a comprehensive e-commerce website. The ideal candidate should have substantial experience in developing multiple combo offer pages like Buy1-Get1,Buy2-Get2 & Buy3-Get3 pages, gif...(Pay U or Phone pay) Note: 1)This project demands extensive brainstorming, open discussions & most importantly a strong willingness to take on the challenge and deliver results 2)Figma model/prototype is available but that is only for idea purpose and its not a response figma 3)3rd Party API: Delivery partner, SMS Packages, DLT Registration & Payment Gateway all are ready 4)Document is also available for reference, consider the document to be around 80% as rest 20% wil...

    €256 Average bid
    €256 Oferta mesatare
    26 ofertat

    ...compatible with the Figma design and implemented using .NET framework 8, SQL server DB, JavaScript, and AJAX (in search). - Two language versions are required: Arabic and English. - All website functionalities need to remain unchanged, including user authentication, data reporting, real-time updates, and all existing links and data. Some links should be editable from the control panel to open external links ; So you need to use same control panel (I Well provide old source code). - Integration of social media into the new version. - You are responsible for publish website on our server (on Google cloud) - We need guides to SEO Ideal Skills: - Strong UI/UX design capabilities. - Extensive web development experience, particularly with .NET framework 8, JavaScript, and AJAX....

    €450 Average bid
    €450 Oferta mesatare
    126 ofertat

    I'm seeking a skilled React Developer to spearhead our Front End development efforts. You will be responsible f...React within the Microsoft stack - Optimize RESTful APIs for our data-driven applications - Ensure high code quality through regular governance and reviews - Collaborate with various teams and customers in an Agile setting Requirements: - Over 4 years of hands-on experience with React, JavaScript, HTML5, and CSS - Proven expertise in REST API development and Agile methodologies - Familiar with the .NET stack and modern Front End tools such as Babel and Webpack Desirable: - Knowledge of Azure - Experience in regulated industries If you're an experienced React Developer looking to take the next step in your career with a dynamic, growth-oriented company, I enc...

    €30 / hr Average bid
    €30 / hr Oferta mesatare
    88 ofertat

    I have released a new mobile word game which I now need a promitional video for to share for Google advertisment and through other medias. I need it done already this week and I need it to look very profession, fun and addictive, to be able to beat the other popular word games out there. :)

    €101 Average bid
    €101 Oferta mesatare
    76 ofertat

    I have a collection of printed documents containing text data that need to be entered into a Word document. The ideal freelancer for this task should possess the following skills and experience: - Excellent typing skills with a high level of accuracy - Proficient in Microsoft Word - Prior experience in data entry - Attention to detail - Ability to maintain confidentiality and handle sensitive information with discretion.

    €170 / hr Average bid
    €170 / hr Oferta mesatare
    1 ofertat

    I'm in need of an administrative assistant in Bolivia who can help me in a adminsitrative task. The primary task will be organizing and filing these documents. Ideal Skills and Experience: - Prior experience in document management - Excellent organizational skills - Trustworthy and able to handle sensitive information - Fluent in Spanish and English - Familiarity with personnel records

    €52 Average bid
    €52 Oferta mesatare
    7 ofertat

    I'm looking for a skilled translator to help translate English to Farsi. It is a small job with the possibility of future collaboration. Ideal Skills and Experience: - Proficiency in English and Farsi/Persian - Prior experience translating general correspondence - Attention to detail and commitment to maintaining the original tone and intent of the source content. Please contact. Thanks

    €4 / hr Average bid
    €4 / hr Oferta mesatare
    35 ofertat

    All the details are included on this document: please DOWNLOAD the document on your device within 2 days of accepting the project. File Name: AT_SIANA Ep x Feroz_Photo Editing Project and Directions Link:

    €39 Average bid
    €39 Oferta mesatare
    1 ofertat

    I need a webmaster for a small, urgent task. I have a domain, hosting on OVH, and a WordPress subscription. The domain is connected to OVH and my DNS is configured. Now, I need help with: - Connecting my "Work In Progress" WordPress page to my domain. - Accessing files hosted...subscription. The domain is connected to OVH and my DNS is configured. Now, I need help with: - Connecting my "Work In Progress" WordPress page to my domain. - Accessing files hosted on my FTP. I'm able to upload but can't access them via a browser. Currently, any URL pointing to my file redirects to the OVH "Site under construction" page. The types of files I'm trying to access are various document types. I would appreciate your prompt assistance, as this i...

    €112 Average bid
    €112 Oferta mesatare
    102 ofertat
    Medikations App
    6 ditë left
    Të verifikuara

    Ich benötige einen Entwickler für .NET MAUI, welcher eine Medikations App erstellen kann für das Kommissionieren von Medikamenten. Der Kommissionierprozess sieht ähnlich aus wie bei einem Logistiker. Weitere Details folgen in einem Meeting. Ausschliesslich deutsch sprechende Entwickler!

    €37 / hr Average bid
    €37 / hr Oferta mesatare
    25 ofertat

    I'm looking for a skilled digital marketer to help boost sales for my document creation business. I have an existing leads database that will be utilized for this campaign. Key Responsibilities: - Craft and implement a strategic digital marketing plan focusing on promotional offers. - Use primarily Email, SMS, and WhatsApp for dissemination of promotional content. - Optimize the campaigns to generate more sales. Ideal Skills: - Proficiency in digital marketing, particularly in utilizing Email, SMS, and WhatsApp. - Experience in crafting promotional content. - Ability to analyze and optimize campaigns for maximum sales generation.

    €108 Average bid
    €108 Oferta mesatare
    13 ofertat

    I'm seeking a web developer to create two distinct websites - a job board and a travel-focused site. Job Board Website: - Utilize a WordPress template for efficient and quality development. - Key functionalities include resume submission, job search and filtering, and an employer dashboard. Travel Website: - This site should facilitate payment for Evisa applications. - Integrate a secure and reliable system for Credit/Debit Card transactions. Please quote separately for each project. Use the word 'Banana' in your message to confirm you've read and understood the requirements.

    €214 Average bid
    €214 Oferta mesatare
    164 ofertat

    We are looking for an experienced content writer with expertise in the furniture or home decor niche to create a 2000-word blog post on the topic "Sheesham Wood vs Teak Wood: Pros, Cons, and Key Differences." The blog should be detailed, well-researched, SEO-optimized, and written in an engaging and easy-to-read tone. Key Requirements: Primary Keyword: Sheesham wood vs teak wood Secondary Keywords (To be used naturally): Sheesham wood furniture Teak wood furniture Sheesham wood Teak wood Content Guidelines: Word Count: 2000 words. The content must be human-written, plagiarism-free, and pass AI content detectors. Maintain a Grammarly score above 85 with a readability score above 55....

    €12 / hr Average bid
    €12 / hr Oferta mesatare
    33 ofertat