Vb net virtual keyboard punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I have a restAPI build in .net and I have implemented AWS SES and SNS for some reason i am not able to receive the message. My source code is working, but i think i may not be properly configuring my end. I need someone with aws account and have knowledge in .net to be able to help me with this task is pleain simple review the SMS and email API to see how i set it nupa dn test them with their account and that way i am able to tell if my aws setup is the issue and assist me with it
I'm looking for a virtual assistant/ freelancer to help me with an affiliate program, promoting services targeted towards individuals and small businesses. Pay- 1 USD per acquired customer you bring Target- 10 customers a day Duration: 1 month - Proficiency in one-one marketing, social media marketing, email marketing, and Content marketing - Proven track record in sales, particularly in affiliate programs - No invalid email ids/ bots or fake users allowed - Each customer must signup to the service from his own device
Job Description: Freelance Web Developer/Designer Position: Freelance Web Developer/Designer Location: Remote Duration: Project-based (with potential for ongoing collaboration) Start Date: ASAP Must Needed Skills: .Net, HTML, CSS, JS About Us: We are a dynamic software company specializing in innovative solutions for our clients. Our website and product theme pages are due for a redesign to better reflect our brand, improve user experience, and align with modern design trends. We are looking for a skilled freelancer who can bring creativity and technical expertise to this project. Responsibilities: Redesign and Development: Redesign our company website and product theme pages to enhance visual appeal, usability, and responsiveness. Ensure the design is consistent with our bran...
...Requirements: - Develop a GUI interface compatible with Windows. The interface should be able to display basic image volume, and detailed metrics and analysis. It should also include interactive segmentation tools. - The project is focused on pancreas detection using MRI and CT scan images, and I have a dataset, research paper, and GitHub link for this project that I can share. - Replace the existing nnU-Net algorithm with a better one, such as SAMed (Segment Anything Model). - The project should be developed using Python. Ideal Skills and Experience: - Prior experience in developing GUI applications for image processing. - Proficient in Python and has a good understanding of GUI libraries in Python. - Familiar with AI and image segmentation algorithms. - Experience in working w...
I am seeking a highly organized and proactive Executive Virtual Assistant to support me, the Marketing Director, at a private jet company. The ideal candidate will assist with project management, coordinate marketing initiatives, and manage social media accounts to enhance our online presence. Excellent communication skills and the ability to multitask in a fast-paced environment are essential. If you are tech-savvy and have a passion for the aviation industry, we want to hear from you! Being skilled in Notion is a huge plus as I am a HUGE Notion nerd and love systemizing things. Other things that will help you stand out: Creating automations in Strong AI skills Great eye for design Good ideas for marketing
I need a professional web developer to help me convert my current .aspx project website to PHP. The new site must be fully functional on a Linux Debian system. Key Requirements: - Extensive experience with both .aspx and PHP - Deep understanding of standard .NET frameworks, as the current site uses these - Proficient in MySQL, as this is the database system currently in use - Familiar with Linux Debian systems Please note that the functionalities of the current .aspx website were not specified, so the developer may need to reverse engineer some elements. A keen eye for detail and problem-solving skills will be essential to ensure a seamless transition.
I am seeking a bilingual (English & Spanish) Virtual Assistant with experience in the healthcare industry. This role involves a combination of customer service, scheduling appointments, and managing emails. We will start with 10-15 hours per week and gradually go to 40 hours per week (M-F, 8:30-4:30 CST) by April. Key Responsibilities: - Customer Service: You will be dealing with our clients, addressing their inquiries and providing top-notch service. - Scheduling Appointments: This will involve coordinating with both our team and our clients. - Managing Emails: You will be responsible for filtering and responding to emails in a timely manner. - Billing, timesheets and accurate data entry. The ideal candidate will have: - Excellent bilingual communication skills (English &am...
I have years of experience in Website management and SEO and have helped rank many sites(ranking guarantee in 60 days). I have a four-step process (SAVE hundreds in value with the best SEO on the net) ?1/. Increase URL rating - IF YOU? are looking at SEO services you need a good URL score ideally you want it to be a minimum of 60. You can not get the top 3 of Google searches without it. I Will Increase Your URL Rating 60+ Within 10-20 Days Guaranteed. I will also increase your Domain Aurthority to 40+ once the backlinks are indexed(MONTH 2 domain rating and trust flow) ?2/. Manual Easy to understand SEO Audit report Website audit is a must it will narrow down to the exact issues and save you Audit includes ● XML Sitemap Errors ● Robots' Errors ● Spam Score Checking and m...
...Native or bi-lingual ASP.NET experience essential - minimum 3 years .NET Core experience essential - minimum 3 years Proven work experience as a Mobile App Developer or Web App Developer. Experience with mobile and web development frameworks such as Ionic, React Native, Flutter, or Angular. Solid understanding of the full mobile and web development lifecycle. Proven experience as a Senior Web Developer / Front End Developer or similar role, with a strong portfolio of web development projects Expertise in modern web development technologies and frameworks such as JavaScript and React. Aware of best practices in implementing functionality into UI/UX design Desirable experience, an understanding of C#, ASP.NET, SQL and .NET Core for back-end integration. No agencies...
...Native or bi-lingual ASP.NET experience essential - minimum 3 years .NET Core experience essential - minimum 3 years Proven work experience as a Mobile App Developer or Web App Developer. Experience with mobile and web development frameworks such as Ionic, React Native, Flutter, or Angular. Solid understanding of the full mobile and web development lifecycle. Proven experience as a Senior Web Developer / Front End Developer or similar role, with a strong portfolio of web development projects Expertise in modern web development technologies and frameworks such as JavaScript and React. Aware of best practices in implementing functionality into UI/UX design Desirable experience, an understanding of C#, ASP.NET, SQL and .NET Core for back-end integration. No agencies...
Estou procurando freelancers altamente qualificados para uma colaboração de longo prazo em um projeto inovador. A tarefa envolve a criação de imagens e vídeos exclusivos de um influenciador virtual que entrelaça estilo de vida, marketing digital e entretenimento. O conteúdo será produzido seguindo scripts detalhados, aderindo aos princípios éticos e em conformidade com as diretrizes da LGPD. Foco no conteúdo: - A ênfase principal do conteúdo do nosso influenciador virtual será no marketing digital. Tipos de Vídeo de Entretenimento: - Nosso objetivo é produzir uma gama diversificada de conteúdo de entretenimento, incluindo vlogs diários, desafios vi...
...goes through trusted IPs. We’re open to your suggestions on how to best handle this. I'm looking for a professional who can assist me in setting up a proxy solution to redirect traffic. The main purpose of this project is to bypass certain restrictions. We previously hired a developer who built the proxy functionality using the GuzzleHttp module in Laravel/PHP. This implementation acts as a virtual environment for a web browser, allowing URLs to be passed through the proxy to retrieve responses from the provider's server. While the solution works sometimes, it frequently encounters errors and is not consistently reliable. This inconsistency is the main issue that needs to be resolved. We need an experienced developer to troubleshoot and fix an issue with our p...
I'm looking for an AutoHotKey, PowerAutomate or Macro Express professional to create a script for simulating mouse and keyboard events. Key Requirements: The script should capture events from a foreground window and replicate them in a background window with a 10-second delay maximum. e,g - we have two ms paints running, we draw something on a ms paint in foreground, the same is automatically drawn on mspaint in background. - this can happen with 10second lag or less - both background and foreground windows are maximized. Ideal candidates should have significant experience with AutoHotKey, and ideally have previously developed similar scripts. Good understanding of Windows applications and ability to implement variable time delays is a must.
...provide a logo and a domain. Please apply if you have the necessary skills and experience, and we can discuss the project in more detail. Updated Project Details: AI-Driven Meal Planner o Create customized meal plans based on dietary preferences, allergies, health goals (e.g., weight loss, muscle gain), and cultural cuisine preferences. o Include grocery lists and integration with delivery apps. Virtual Fitness Coach o Offer AI-guided home workouts tailored to fitness goals, age, and physical limitations. o Track workout performance through real-time motion analysis using a smartphone camera. Mental Wellness Tools o AI-powered journaling and mood-tracking tools. o Guided meditations and stress-relief techniques based on user behavior and feedback. Preventive Health Alerts o ...
...schemes** that align with the brand identity. ✅ **Unique and modern slide templates** for a professional look. ✅ **Smooth transitions and dynamic animations** for a seamless experience. ✅ **Well-structured and elegant formatting** to effectively convey key messages. ### **Deliverables:** - **PowerPoint / Keynote / Interactive PDF** presentation - Optimized for **large-screen displays and virtual meetings** - **Fully editable text and content** for future modifications **Preferred Skills & Experience:** - **3D design, motion graphics, and UX/UI expertise** - Experience in **brand storytelling and corporate presentations** ? **Please include samples of similar work in your proposal.** ? **Got creative ideas? Let’s collaborate to make this prese...
I'm looking for an experienced professional to design a comprehensive semester-long plan for a student-led filmmaking club at a high school level. The primary focus of the club should be on educating members about various aspects of filmmaking, including scriptwriting, storyboarding, technical filming, and acting. Key respon...extracurricular program design. • Strong understanding of filmmaking fundamentals, including storytelling, cinematography, and editing. • Ability to create structured, detailed, and visually appealing lesson plans and resources. • Excellent communication skills and the ability to inspire creativity in students. • Experience with student-led or extracurricular clubs is a plus. • Familiarity with virtual tools for colla...
...email notifications for: Offer requests Booking confirmations Payment confirmations Travel reminders and vouchers Post-trip feedback requests (e.g., TrustPilot) • Data Consistency: o All customer and booking information feeds into a centralized CRM database. o Ensure accurate and consistent data across all processes. 6. Provider and Inventory Management • Hotel and Golf Contracts: o Upload net rates, booking conditions, seasonal pricing, and inventory details. o Manage inventory types (e.g., single rooms, suites, villas, green fees, tee times) with automation for availability and pricing updates. • Operational Booking: o Automate communication with hotels and golf courses, including customer details, booking confirmations, and operational requirements. o ...
I'm looking for a dedicated virtual assistant to help manage my social media presence on Facebook, Instagram, and Twitter. Key Responsibilities: - Scheduling Posts: You'll need to plan and schedule content across these platforms to keep my audience engaged and informed. - Community Engagement: Interacting with followers, responding to comments, and fostering a positive online community. Ideal Skills: - Proficient in using Facebook, Instagram, and Twitter - Experienced in social media management - Able to engage and communicate effectively with an online community - Good understanding of content scheduling and planning
Suporte Administrativo: - agendamento de reuniões; - organização de arquivos, emails; - comunicação interna e externa; - processos e procedimentos (formulários, e-mails, comunicados); - organização de base de dados, fotos, etc.
I'm in need of a seasoned C#/.NET Full Stack Developer. Although specifics weren't mentioned, I'm open to discussing web application, desktop application, or API development. The ideal candidate would be proficient in: - C# and .NET Framework - Full stack development - API integration and development Experience with SQL Server, MySQL, or NoSQL databases would be beneficial. Please feel free to propose suitable frontend technologies, but proficiency in React, Angular, or Vue would be a plus.
I'm looking for a cross-platform mobile app (iOS and Android) that incorporates a virtual assistant with automated responses. The primary function of this virtual assistant would be to handle product information queries. Key Features: -Create AI agent that can browse the net looking for shopping deals - Designed for both iOS and Android platforms - Incorporation of a virtual assistant - Automated responses to product information queries - Ideal Skills and Experience: - Proficiency in cross-platform mobile app development - Experience with integrating virtual assistants in mobile apps - Solid understanding of automated response systems - Knowledge about product information query handling systems
Bir hap eğitim uygulaması düşünüyorum. Ücretli p2p video görüşmeleri ve ücretli yorumların yapılacağı bir mentör-öğrenci platformu olacak. Belirli bir sektör için olacak. Şu anda logo domain vb. kimlikler hazır. Yapısal olarak detayları ayrıca toplantıda görüşebiliriz. Bu uygulama sonrası sürekli bakimi ve geliştirme olacaktır o yüzden uzun süreli bir çalışma ön görüyoruz. Note for foreign freelancers; Fluent Turkish language is a must here. Thank you.
I'm seeking a proficient trader to manage my prop account with Sure Leverage, initially funded by $50k. - Commission: I offer a 30% commission on net earnings every month. - Trading Strategy: The preferred strategy for this account is Day Trading. - Instruments: The focus will solely be on Forex. - Risk Level: The trading strategy should maintain a Medium risk level. Your role will be to respect the rules of the prop firm while ensuring consistency in our trading endeavors. The ideal candidate should have a proven track record in day trading Forex, with the ability to balance profitability and risk.
I'm in need of a virtual administrative assistant to help with various tasks. Key Responsibilities: - Managing my email - Scheduling appointments - Assisting with data entry Ideal Skills: - Excellent email management skills - Proficient in scheduling - Strong data entry capabilities I prefer to communicate via email. Experience with virtual assistance is a plus. Please bid if you're organized, efficient, and can handle a busy schedule.
URGENT!! Property Manager/Virtual Assistant We are excited to announce an opening for a dedicated and organized full-time Virtual Assistant to join our dynamic team. In this pivotal role, you will provide essential support to our team by assisting with a wide range of administrative tasks that are critical to our operations. The ideal candidate will possess strong proficiency in listing and managing properties on the platform. The chosen candidate will be focusing on efficient property setup, account management, and seamless customer service to facilitate smooth operations and guest bookings. You will also be tasked with drafting and responding to emails, maintaining documents, and assisting in the preparation of reports and presentations. Strong communication skills are e...
...independently and meet deadlines. Good communication skills and attention to detail. Portfolio of previous game development projects is a plus. Preferred Skills: Experience with Unity Asset Store tools and assets. Knowledge of game monetization techniques (e.g., in-app purchases, ads). Experience in integrating Unity with backend systems (e.g., Firebase, PlayFab). Knowledge of virtual/augmented reality (VR/AR) game development (optional). Payment: This is a freelance position with payment based on the scope of the project. Rates are negotiable depending on experience and project requirements. How to Apply: Please provide your resume, a brief cover letter, and links to your previous Unity game projects or portfolio. We are looking for someone who is pa...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
...remote communities. Open Communication Encouraging children to express their feelings and fostering supportive family dynamics can improve emotional resilience. Parenting workshops and community support groups can aid in this process. 5. Leveraging Technology Mobile applications and online platforms can offer mental health resources, including self-help tools, hotlines, and virtual counseling sessions. Conclusion The mental health of Indonesian children is a pressing issue that demands immediate attention. By addressing the root causes and implementing comprehensive strategies, Indonesia can create a supportive environment where children can flourish both emotionally and mentally. Ensuring the mental well-being of the younger generation is not just an investment in the...
I'm looking for a week-long, in-person, hands-on interactive .NET and c# training for 8-10 developers in Mumbai. The training should focus specifically on c# , core concepts , Entity Framework, Microservices Architecture, MVC, and Web Development. Ideal Skills and Experience: - Proficient in .NET core and c# - Experienced in conducting hands-on coding workshops - Deep understanding of Entity Framework, Microservices Architecture, MVC, and Web Development - Excellent teaching and communication skills - Ability to engage and motivate advanced learners
I am looking for the only US partners. I'm in search of a dedicated, part-time virtual assistant to help manage and grow my personal business. This role is flexible, fully remote, and offers long-term potential. Key Responsibilities: - Customer Support: Responding to inquiries and providing assistance to customers. - Social Media Management: Overseeing our business presence on Facebook, Instagram, and Twitter. Ideal Skills: - Proficiency in Email and Chat platforms for seamless communication. - Experience handling Phone systems. - Prior experience in Customer Support and Social Media Management. I will begin with a lower rate/budget, but I'm committed to increasing the rate based on performance, either monthly or yearly. Required Locations: - United States If you b...
We are a tourism company seeking a skilled Virtual Assistant with expertise in social media management and email marketing to help grow our online presence and streamline our digital marketing efforts. This is a remote role that requires attention to detail, creativity, and marketing knowledge. Key Responsibilities: Manage and schedule posts on Instagram, Facebook, and LinkedIn. Design and create eye-catching flyers, promotional videos, and graphics using tools like Canva or Adobe. Develop and execute email marketing campaigns via Mailchimp, including designing templates and tracking performance. Monitor and engage with followers on social media to build our brand. Report on campaign performance and suggest improvements. Requirements: Proven experience in social media management ...
We are looking for...with smart contracts and blockchain technology to decentralize key features. Integrate wallet functionality using thirdweb SDK. Adaptation to Existing Codebase: Build on our current MVP (developed with , React (TypeScript)). Collaborate with a backend built in .NET (C#) with Azure and SQL databases. Requirements: Technical Skills: Proficiency in , React, TypeScript, and thirdweb SDK is essential. Familiarity with blockchain technology and smart contract integration. Experience working with a backend built in .NET and Azure is a plus. Strong ability to match Figma designs and create responsive, modern UIs. What We Provide: Access to our existing MVP and codebase. Figma design files and detailed requirements. Clear guidance and support from our internal te...
I'm an experienced virtual assistant with over 15 years in providing remote administrative services. I am known for my accuracy, speed and commitment to meet client needs efficiently. My goal is always to save time and effort for my clients by providing outstanding administrative solutions. I am looking for help with the following specific tasks: - Email management and appointment scheduling - Writing and formatting university research and graduation projects - Creating business reports Ideal skills and experience for this role would include: - Proficiency in email management and scheduling - Excellent writing and formatting skills - Experience in creating business reports - Strong research skills for university projects - Commitment to quality and timeliness Please note, I ...
I'm seeking a proactive Virtual Assistant to help my online event planning website run smoothly. This role primarily revolves around content creation and updates, managing relationships with external service providers, creating and managing events, and assisting with our marketing efforts including social media and influencer marketing. Key Responsibilities: - Content Creation and Updates: This is the highest priority task. You'll be responsible for updating our social media with engaging content and maintaining our in-house built events, products and service offerings. - Event Management: You'll be creating and managing events on our platform. - External Collaboration: Working with our external service providers will also be part of your role. - Marketing: Helpi...
I'm in need of an experienced web app developer proficient in ASP.NET and SQL Server. The primary purpose of this web application is data management. Key Requirements: - Creation of user roles, specifically an Admin role. - Development of core functionalities including data entry forms and reporting tools. Ideal Skills: - Extensive experience in ASP.NET and SQL Server. - Proven track record in developing data management web applications. - Expertise in implementing user roles and core functionalities.
I am seeking a certified Accessibility Auditor to conduct a comprehensive accessibility audit on many of our native/hybrid mobile apps on Android and iOS. The evaluation should follow WCAG and ADA guidelines. This is a long-term Hourly project. Key Responsibilities: - Perform extensive screen reader (Talkback & Voiceover), Keyboard, and Color Contrast inspections on Android and iOS devices. - Thoroughly assess all accessibility aspects of the mobile app. - Prioritize findings into High, Medium, and Low categories according to severity. - Provide a detailed PDF report with a recommendations section, including example code for necessary updates. Ideal Candidate: - Certified by DHS or IAAP with proof of certification. - Has a portfolio of previous Mobile Accessibility Testing rep...
I'm looking for a skilled software developer to create a comprehensive CTS Virtual Clearing Software for Windows. This software should cater primarily to bank staff and administrators, featuring core functionalities such as cheque scanning and processing, automated clearing and settlement, and reporting and analytics. Key Features: - Cheque Scanning and Processing: The software should be capable of efficiently scanning and processing cheques. - Automated Clearing and Settlement: I need a system that can automate the clearing and settlement process. - Reporting and Analytics: The software should have strong reporting and analytics capabilities. Ideal Skills and Experience: - Proficient in Windows software development - Experience in developing financial or banking software - ...
I'm looking for an experienced mobile app developer to build a social-interaction-focused, live-streaming app for both iOS and Android in native form. The app should have features like real-time chat, user profiles, and friend lists. A crucial aspect of this app is the integration of a digital currency that users can spend to purchase virtual check reference app I you can't build an app with this clean of code or as smooth as this app runs please don't message me. I'm only hiring the best for this project Key Requirements: - Proficiency in native iOS and Android app development - Experience with building live-streaming applications - Knowledge of integrating digital currency systems - Skills in implementing real-time chat
Presupuesto 18 dolares proyecto consiste en la creación de una escena virtual con un modelo ya existente, que deberá ser enriquecida con elementos interactivos y detalles visuales específicos. Requisitos del proyecto: Ambiente: Añadir vegetación, agua y una roca que simule sostener una parte del modelo. Diseño de espacio sencillo y propio. Configuración de "POSTPROCESS VOLUME" y "LIGHTMASS IMPORTANCE VOLUME". Materiales y objetos: Crear al menos un material nuevo (no usar los de "Starter Content"). Incluir al menos un objeto con movimiento al acercarse. Interactividad: Implementar un "TRIGGER VOLUME" para activar animaciones. Crear animaciones con "TIMELINE". Incluir un menú i...
...and provide real-time multiplayer functionality. Below are the details: 1. Game Features: Classic Ludo gameplay with intuitive and attractive design. Real-time multiplayer mode (2-4 players). Private room creation and quick match options. Smooth animations and minimal lag for seamless user experience. 2. Payment System: Integration of secure online payment gateways (e.g., UPI, wallets, net banking). Automatic processing of payouts to winning players' wallets or accounts. 3. Admin Panel: A backend dashboard for managing: Game statistics (matches played, winners, etc.). User accounts and payments. Prize distribution. 4. Additional Features (Optional): Chat functionality within matches. Leaderboard for top players. Daily rewards or referral bonuses. ...
I'm in need of a seasoned .NET developer with expertise in Angular 16 for the development of a comprehensive HR Management System (HRMS). This system will be built on .NET Core and will incorporate several key HR modules, including: - Payroll Management - Employee Self-Service - Recruitment Management The ideal freelancer for this job should have a robust understanding of both .NET Core and Angular 16. Previous experience in HRMS development is highly desirable, as is a strong portfolio demonstrating successful .NET and Angular projects. Your ability to create user-friendly interfaces and efficient back-end systems will be critical to the success of this project.
I'm a professional translator with exceptional writing and content creation skills to work on translating marketing materials from English to Arabic. Key Responsibilities: - Translate marketing materials from English to Arabic - the translated texts are engaging and suitabl...Experience: - Proven experience in translating marketing materials - Exceptional writing and content creation skills - Ability to deliver high-quality work under tight deadlines - Native or near-native proficiency in Arabic and English am interested in offering my services in various fields. I am motivated to apply my skills and provide high-quality work to clients. Whether it is writing, design, virtual assistance, or other professional services, I am eager to contribute and work collaboratively to a...
I'm in need of a versatile and tech-savvy Virtual Assistant to help with various tasks in my business. Your responsibilities will primarily revolve around Canva, Flo Space, and Kajabi. I am a photographer based on the sunshine coast QLD Key Responsibilities: - Canva: You'll be designing presentations and developing marketing materials. - Flo Space: Your role will involve creating email campaigns and analyzing their performance. making funnels. - Kajabi: You'll be assisting with sales funnel integration, adding my course to the site and different products. Ideal Candidate: - Proficient in Canva, with a flair for design. - Experienced in email marketing and campaign creation. - Knowledgeable about Kajabi and sales funnel integration. - Able to handle general busin...
Presupuesto 20 dolares proyecto consiste en la creación de una escena virtual con un modelo ya existente, que deberá ser enriquecida con elementos interactivos y detalles visuales específicos. Requisitos del proyecto: Ambiente: Añadir vegetación, agua y una roca que simule sostener una parte del modelo. Diseño de espacio sencillo y propio. Configuración de "POSTPROCESS VOLUME" y "LIGHTMASS IMPORTANCE VOLUME". Materiales y objetos: Crear al menos un material nuevo (no usar los de "Starter Content"). Incluir al menos un objeto con movimiento al acercarse. Interactividad: Implementar un "TRIGGER VOLUME" para activar animaciones. Crear animaciones con "TIMELINE". Incluir un menú i...
I'm looking for an expert in social media who can develop and execute a comprehensive plan for promoting a brand on Facebook, Instagram, and LinkedIn. The primary focus will be on creating promotional content aimed at increasing brand awareness. There may be additional Virtual Assistant/PA duties that will also be required to be completed. Key Responsibilities: - Develop a strategic social media plan targeting brand promotion - Create engaging and effective promotional posts for Facebook, Instagram, and LinkedIn - Monitor and report on the effectiveness of the social media campaign - Ad-hoc administrative tasks as directed Ideal Skills: - Proven experience in social media management - Excellent content creation skills - Strong understanding of Facebook, Instagram, and Linked...