Vb net create iis hosting punët
ping me
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
test porject test porject test porject test porject test porject test porject test porject test porject test porject
Web Hosting explode hosting Klikoni Reklamat
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Issue: - a standard staff profile. Clicking within the red area displays a popup with the employees details. Clicking on the purple area expands/collapses the direct reports <- this area is tiny, resulting in users often getting the employee information instead. - is an example of some of profile cards with the direct reports expanded or collapased. Example 1 and 2 png shows some possible solutions to make the clickable area larger i.e. make the button bigger, add a grey line which adds seperation for the 2 click actions, add a different colour section which again seperates the 2 click actions. The new design needs to look slick, has to be usable and makes sense to the user. Maybe provide a couple of ideas to show your thinking; which can be narrowed down to the final design. I...
I'm seeking a talented and experienced landing page designer/developer to create a high-converting landing page for my web application, "Persuadr." I'm looking for someone who can deliver an initial concept in Figma within a week. About Persuadr: Persuadr is an AI-powered job proposal generator designed to help freelancers and job seekers (both experienced and new) significantly reduce the time and effort required to create compelling, tailored job proposals. By analyzing job descriptions, company information, and user profiles, Persuadr automati cally generates customized proposals, helping users land more jobs. Project Goal: The primary goal of this landing page is to maximize user sign-ups and encourage visitors to try out Persuadr. The page needs ...
...developed for hosting educational content focused on government exam preparation. Key requirements: Core Features: - Secure user authentication system for students/viewers - Video hosting and streaming capabilities with organized course sections - Content management system for easily uploading and organizing videos and study materials - Mobile-responsive design for seamless viewing across devices - Search functionality to help students find specific topics - Progress tracking for students to monitor their course completion Technical Requirements: - Video compression and optimization for smooth playback - Secure payment gateway integration for course purchases - Admin dashboard to manage content, users, and analytics - Cloud storage integration for video and document h...
I'm looking for someone with advanced skills in Coolify, who can help with the automatic hosting of my Laravel application. The ideal candidate will have experience with both Docker and non-Docker environments in Coolify. Key Responsibilities: - Primarily focused on the automatic hosting of a Laravel application - Utilizing both Coolify with Docker and Coolify without Docker - Potentially assisting with other custom applications like and Node.js Additionally, the chosen freelancer will be required to create step-by-step documentation of the hosting process, so strong written communication skills are essential. This project would suit someone who is technically proficient and can communicate complex processes in a clear, accessible way.
I am looking for a skilled app developer to create an event management app for my startup. This app will be available on both iOS and Android and will serve as a platform for hosting and managing parties. Key Features: - Event Booking System: Customers should be able to easily book tickets for various events. - User Verification: A robust system for verifying users, primarily through ID document uploads. The ideal candidate for this project should have experience in developing cross-platform apps and a strong understanding of event management systems. Please provide examples of similar projects you've worked on in your proposal. The app should include an in-app chat feature for event organizers and attendees to communicate easily. Please integrate the payment system...
We are seeking an experienced Full-Stack Developer proficient in , React, and MongoDB to develop a Progressive Web Application tailored for the fintech sector. The ideal candidate will have expertise in deploying on modern hosting solutions like Vercel, Railway, and AWS, ensuring optimal performance and scalability. Responsibilities: Develop and deploy a fintech PWA using and React, focusing on performance, scalability, and security. Integrate MongoDB for data management, ensuring efficient data handling and responsiveness. Leverage serverless architecture on AWS to manage backend functions and processes. Utilize Railway for continuous integration and Vercel for deployment to streamline development and ensure high availability. Collaborate with a UI/UX designer to implement
I'm in need of a virtual assistant who can help drive sales for a web hosting service through social media outreach through one-one marketing. Key Responsibilities: - Identify and Attract potential leads who wants to buy a monthly web host plan - To buy a web host plan, the user must have a domain name ready. It could be a recently purchased domain or an old unused domain. - Engage with each lead to generate interest in the services, one-to-one. - Proficiency in one-one marketing, social media marketing, and Content marketing Pay- 10 USD per paying customer you bring (Fixed) Target- 10 customers a day Duration: 1 month - Your unique affiliate link will be shared to you - Pay will be released on reaching daily targets/ milestones - No upfront or no campaigns fee or other cha...
Project Description: I am looking for a game developer to build a simple online game where players take on the role of a household bug crusher and crush different types of bugs to earn points. The game should be browser-based and allow users to sign up, play instantly, and compete on a leaderboard. Project Features: User Authe...for milestones (e.g., "You just made it to the Top 10!"). Additional Features (Optional but Preferred): Basic animations & fun sound effects. Mobile-friendly responsive design. Shareable score (allow players to share their high scores on social media). Technology Stack (Preferred but Open to Suggestions): Frontend: Angular, HTML5 + JavaScript or Unity WebGL, or similar game engine Backend: C# .NET Core (or Node.js/Python if preferred) Databa...
...etc.) Interactive Message Replies (NFM – Non-Forwardable Messages) Project Requirements: Technology Stack: Backend: C# (.NET Core) Database: Microsoft SQL Server ORM: Entity Framework Core Webhook Functionality: Receive and parse WhatsApp webhook events. Store received messages in the SQL Server database. Handle different message types dynamically. Additional Requirements: Code should be well-structured and documented. Ensure scalability and security in processing webhook events. Use dependency injection and follow best practices for .NET development. Preferred Skills & Experience: Experience with WhatsApp Cloud API integration. Strong knowledge of C# and .NET Core/.NET 8. Entity Framework Core . Experience with RESTful APIs and Webhooks. Erro...
I'm looking for a skilled webinar moderator for a marketing-focused event. The moderator's tasks will include introducing speakers, managing Q&A sessions, and handling technical troubleshooting. Ideal candidates should have: - Strong general moderation skills - Experience with managing online events - Ability to handle technical issues on the fly - Excellent communication skil...with managing online events - Ability to handle technical issues on the fly - Excellent communication skills Specific industry expertise isn't necessary, but a familiarity with marketing concepts could be beneficial. Please provide examples of similar events you have moderated in your proposal. The expected duration of the webinar is 1-2 hours. We will be using ZOHO Webinar as the platform fo...
I have an existing wordpress website and now want to update the website with new pages. I have created all the pages in Canva (to show layout, copy and images) and now just need someone to take my designs and layouts and apply them to pages on my website. The pages are; - Home page -Capability page - Case Studies - Products - How we work / FAQ's - Contact us Each of these pages I want to have buttons link to enquiry forms or download forms and then I also have images / videos per page. I need this done ASAP so someone who is available now is best.
...foundation for a fresh start. 2. "Fishing as a Livelihood" () Depicts Venezuelan refugees in Peru learning or working in the fishing industry. The focus is on economic empowerment, showing refugees acquiring skills to sustain themselves. Two variations to choose from: a) A refugee being taught by a local fisherman. b) A group of refugees working together, casting a fishing net, symbolizing community support. The water should feel expansive and full of opportunity, contrasting with the previous struggles of migration. 3. "A New Beginning" – Housing & Shelter () A young Venezuelan refugee family standing in front of their newly built, simple home in Peru. The home represents stability, safety, and a fresh start, funded by Amamericana’s housing
I'm hosting a fishing event focused on the Murray Cod species and I need a talented graphic designer to create a modern and clean logo/badge for the event alongside some supporting graphics. It needs to also include elements from our branding (see attached). The event details are: Social Fishing Members Event Lake Mulwala 4th - 6th April 2025 Key Elements: - The logo should incorporate an illustration of the Murray Cod. - Some subtle hints or illustrations if our branding would be appreciated. - The event name and date should be integrated into the design. Color Scheme: The primary color palette should revolve around shades of blues and greens, reflecting the aquatic theme of the event. Ideal Skills and Experience: - Proven experience in logo and graphic design....
...focus primarily on visual customization and deployment. Scope of Work: UI Customization - Update colors, fonts, and layouts to align with a professional, branded appearance. - Replace default branding with a custom logo, favicon, and design elements. - Adjust input forms, buttons, and navigation for a polished look. - Ensure the interface remains user-friendly and responsive on all devices. Hosting the Application: - Deploy the customized application on a cloud platform (e.g., AWS, GCP, or Azure). - Configure the application to support multiple concurrent users with basic authentication or invite-only access. - Set up HTTPS and ensure the application is secure for external users. - Testing and Deployment: - Validate the functionality post-customization to ensure the system ...
I need assistance in converting a list of businesses from Google Sheets into Avery 8160 labels in PDF format. Details: - The business addresses are formatted in multiple columns in the Google Sheets (i.e., street, city, state). - Please use the Standard Avery font for the labels. - The labels should include the business name and address only.
Project Overview: We are seeking an experienced Wix Velo (Corvid) developer to create a custom review feature for our Wix website. This feature will allow users to submit product/event reviews with the option to upload photos or videos. To encourage engagement, the system should automatically trigger discount codes based on the type of media submitted. Key Features: Review Submission Form: Star rating system (1-5 stars) Text box for written reviews Media upload option (photo and/or video) Responsive design (desktop and mobile compatible) Incentive Automation: Auto-generate a 25% discount code for reviews with photos Auto-generate a 50% discount code for reviews with videos Send discount codes via automated email upon successful submission ing display of reviews with user-submitted ...
just need a live2d model that looks similar to the guy in the attachment . it needs to be model ready
...machine learning model utilizing a confidential dataset. We aim to interact with this model to retrieve specific statuses from our database. Given our offline environment, we will provide the hired individual with access to an isolated virtual machine for development. Planned Components: - Data Storage: We intend to use ChromaDB for storing datasets and documents, as it supports internal local hosting. - Embedding Model: We plan to implement the BAAI/bge-large-en-v1.5 model, which transforms text into 1024-dimensional vectors, facilitating tasks like retrieval and semantic search. ()) - Interactive Model: We are considering the Llama 3.2 1B model for future interactive capabilities. This lightweight, multilingual model is
Videographer Needed for Industry Event in New Orleans – 2/6/25? We’re hosting an exciting industry event in New Orleans, LA on Tuesday, February 6, 2025, and we’re looking for a skilled local videographer to help us capture the day! Event Details: Location: New Orleans, LA [details to follow] Date & Time: February 6, 2025 | 2 -6 pm What You’ll Be Capturing: - Interviews with attendees and speakers - Special moments and key highlights of the event - Speaker sessions and panel discussions - The ambiance and energy of the event What We’re Looking For: A creative, experienced videographer with expertise in live event coverage Ability to deliver: - Raw footage of all recorded moments - A polished, professionally edited highlight reel (3–5 m...
...machine learning model utilizing a confidential dataset. We aim to interact with this model to retrieve specific statuses from our database. Given our offline environment, we will provide the hired individual with access to an isolated virtual machine for development. Planned Components: - Data Storage: We intend to use ChromaDB for storing datasets and documents, as it supports internal local hosting. - Embedding Model: We plan to implement the BAAI/bge-large-en-v1.5 model, which transforms text into 1024-dimensional vectors, facilitating tasks like retrieval and semantic search. ()) - Interactive Model: We are considering the Llama 3.2 1B model for future interactive capabilities. This lightweight, multilingual model is
I'm seeking a proficient professional to assist me with my Microsoft 365 email setup. This includes: - I moved webhosts, the prior webshost email basic platform needs to be changed to Microsoft 365 at my new hosting. - Email Account Creation: Setting up new email accounts for my team and ensuring they are configured properly. - Email Migration: Transfer existing emails from our previous system to Microsoft 365 without data loss. - Configuration and Security Settings: Customizing the configuration settings to suit our needs and implementing necessary security measures to safeguard our emails. The ideal candidate for this project should have extensive experience with Microsoft 365, particularly with its email capabilities. Also, website set-up and maintenace. Knowledge of secu...
I need a web-based system for an online teacher to manage her classes efficiently. The system should have the following features: 1. Calendar & Scheduling A calendar view that displays scheduled classes. Abili...send an email with the meeting link. Reminders should be sent before the class starts. Payment failure or pending notifications should be handled. 6. Admin Dashboard A dashboard for the teacher to: See upcoming classes and registered students. View students' payment status and attendance. Manually mark attendance if needed. Generate reports on students' participation and revenue. 7. Technology & Hosting The system should be a web-based app. Should support scalability for more students in the future. Use a secure database to store student details, class sch...
I'm seeking a unique logo for my pool cleaning business, MoJo Pool Cleaning, located in Aledo, TX. This is a veteran-owned business, and I want to incorporate a military style into the design. Key Aspects: - Military Theme: The logo should have a military style, with elements...Understanding of military design elements and how to incorporate them in a tasteful and professional manner. - Creativity: Ability to come up with unique and innovative design ideas. I am open to new ideas and interpretations, as long as they align with the overall military theme and focus on the business name. If the Marine Corps EGA can be used that would be a bonus. Maybe a Marine carrying a pool net. I am open to any good creative and simple ideas that would be an easy Logo for a small pool cle...
Web to present a company, with the following structure - Header - Intro (Hero Section with impactful image or video) - Benefits Section (with icons and concise descriptions) - Services - Your partner in digitalization (Contact form and info) - Footer It is required a modern and appealing look. Examples can be provided. Texts, Domain, Hosting will be provided. It is expected the contractor provides icons, fonts, videos/images and any other resource. It is expected the contractor provides logo.
Design Notes: -Make "Logan Thompson Autograph Signing at Eavesdrop!" the main headline -Use Washington Capitals colors (red, white, blue) -Feature action shots of Logan Thompson while keeping the layout clean -Showcase Eavesdrop Brewery as the venue and a key sponsor -Neatly place social media icons and include Eavesdrop’s logo -Consider a subtle ice rink or hockey net background Host: Above Average Graphing (AAG) Venue: Eavesdrop Brewery, Manassas, VA Style: Bold, high-energy, professional, hockey-themed Event Details: Date: Sunday, March 2nd | Time: 2:00 - 3:30 PM Location: Eavesdrop Brewery, 7223 Centreville Rd, Manassas, VA Autograph Pricing: -Any Item: $99 | Inscription: $40 | COA: $10 -Rookie Cards: $150 | Game-Used Equipment: Inquire for Pricing Call to Ac...
I need assistance hosting my Angular 7 frontend and C# backend application on AWS EC2. The application uses PostgresSQL for its database. Key Requirements: - You will be working with the final files of the application that I will provide. - Your task is to set up hosting on a Cloud platform, specifically AWS, using EC2 for VM hosting. - Familiarity with Angular 7, C#, and PostgreSQL is highly desirable. - Experience with AWS, particularly EC2, is a must. - Configure SSL certificates to ensure secure HTTPS connections. This project is straightforward for anyone with the right skills and experience. I look forward to your bids! Only the initial deployment setup is required, no ongoing maintenance needed.
...knack for corporate/business sites, to assist with quarterly maintenance of our websites. The tasks will primarily revolve around content updates and design enhancements, according to our existing design materials and branding guidelines. There are not intense steps involved just a check up to make sure that every thing is opening and working well. Must be familiar with navigation of the A2 Hosting site headquarters in the US. This is our host for our 4 web sites. Ideal Skills: - Web Design - Content Management - Knowledge of Corporate Branding -Knowledge of SEO and ranking - Proficiency with popular Content Management Systems (CMS) like WordPress, Joomla, etc. Experience: - More than 5 years experience and college degree - Previous work on Corporate/Business websites - Pro...
Create and publish the Wikipedia page.
i want a developer to adapt whmcs cloudx theme to fossbilling: CloudX - WHMCS Web Hosting + Client Area Template If you are tired of spending endless hours on customization, we got your back. CloudX theme is professionally designed to help you launch your business seamlessly. This theme incorporates a variety of page layouts ready for your services and products. All the pages have been professionally designed to meet your requirements. It draws the eyes of clients with its looks and keeps them shopping with its user-friendly interface. VIEW LIVE DEMO Demo FRONTEND FEATURES 1. Multi layout unique homepage style 2. 15+ Prebuild pages 3. Multi layout VPS/dedicated pricing table 4. Customized order form 5. Extra info for dedicated pricing layout 6. Custom Badge 7. Fully RTL supp...
I'm looking for an Excel expert who can help me create a formula that calculates payment using the FIFO (First In, First Out) method for my invoices. The data is spread across multiple sheets, so the freelancer will need to be comfortable with cross-sheet referencing. Key Requirements: - Expertise in Excel, particularly with complex formulas and cross-sheet referencing. - Previous experience dealing with invoice data - Understanding of FIFO payment calculation The invoice data includes: - Multiple sheets with different invoice amounts and dates - Payment records - A column that indicates how much credit can be taken (PBC) if the credit value is sufficient The ultimate goal is to use this formula to reduce the net credit to be paid. Please note that attention to detail...
Description: Developing a web platform to create and edit interactive virtual tours, where the user can upload 360° panoramic images, add interactive points, and generate a unique link for each tour to share or display. Requirements: 1. Create virtual tours: • Upload 360° panoramic images. • Generate a unique link for each tour. • Create multiple scenes within the tour and link them together. 2. Edit tours: • Add interactive points (links, images, video, texts, transitions between scenes). • Edit and update interactive points easily via a drag-and-drop interface. 3. View tours: • Support for viewing via browser and virtual reality (VR) devices. • Load images and interactive points efficiently to improve performance
...different sections. Below is an example of what it contains. We need to extract each employee and match them with a set of valid employees in our database/dataset based on their company name, ID and partial names and then club them together to create a data extract with relevant details for each employee. Key Requirements: - Extract employee information from activity statement - Find/match with valid employees in our database - human intervention/notification for no match - Extract activity elements under each header for each employee - Ability to create and train model for better accuracy - Deploy/Provision service to submit documents for processing and then fecthing extraction results Ideal Skills: - Proficiency in AI/ML, data modeling and extraction - Proficiency in ...
I would like to make huge ChatGPT lists by typing in a request for a list then keep pasting “more” to make it hundreds of pages long, copy it to a TXT document, copy it to a Word document, save the Word document as a PDF and deliver the 3 documents: TXT Word and PDF. How many pages of the TXT/word/PDF document (a total of 3 times that) will you supply per $1? Your bid doesn’t matter. I will milestone the cost and what to enter each time. When I hire you I will immediately milestone and release your $5 FL fee so it won’t cost you anything to start the project. But before we talk tell me the English word for the next prime number after seven. Charlie
I have simple logo idea. I need someone to draw it. I need real graphic designers! No use of logo templates! No use of AI.
In each product of the specific collection of Tennis Rackets of , I want to give the consumer the option to string (or not) the racket, which means he has to chosse the kind of string he wants + tension of the string. Some examples from competitors are the following:
The project is a website that provides a service for creating and selling 360-degree virtual tours. Customers can purchase a link to their virtual tour, where the tour is filmed, edited, and interactive points are added within it. The site aims to provide a realistic interactive experience for users, such as real estate, hotels, exhibitions, and stores. 2. How it works: • The customer enters the site and chooses the appropriate service. • The virtual tour is requested and the fees are paid through the site. • After payment, a link for the virtual tour is created. • 360° images or videos are uploaded and edited using interactive tools. • Interactive points such as texts, images, videos, or links are added within the tour. • The customer gets a special lin...
Please create a staging site for so I can make updates and once those updates are completed please put back the updated website on to the domain.
I'm looking for an experienced Android app developer to build a 2D Number Game with both front and backend. The game should be designed for both Android and iOS platforms. Key requirements: - Comprehensive handling of all required services and hosting. - Complete project handover upon completion. - Expertise in 2D graphics game development. - Future-proofing for potential iOS support. - Prior experience in developing puzzle games is a plus. Please provide examples of your previous work in your proposal.
...include: ✅ Influencer Discovery & AI Matching • Search & filter influencers from: • Snapchat API • TikTok API • Instagram Graph API • Facebook API • LinkedIn API • AI-powered recommendations based on engagement, demographics, and past campaigns. • GCAM licensing verification (Saudi law compliance) to ensure only authorized influencers operate. ✅ Campaign Management System • Brands can create campaign briefs and specify: • Budget & compensation model (fixed, commission, revenue share). • Post requirements (images, reels, videos, stories). • Approval workflow before influencer posting. ✅ Performance Analytics & Fraud Detection • Real-time tracking of engagement (likes, shares, CTR, R...
