Sample vb projects college punët
...customers solving problems with deliveries, tracking parcels online (EestiPost, Omniva, DPD, TNT, FedEx, UPS, etc…) handling issues reported by clients with products delivered, managing issues in case of delays, making orders modification, invoice modification, address modification, managing communication about returns, disputes, refunds, etc… Quality assurance: performing quality inspection of the sample of the products manufactured in order to escalate with factories possible faults and quality fluctuations issues whilst following up with customers who have been affected by production issues. Online technical support and troubleshooting: supporting customers when payment error occur, issuing credit card refunds, spotting technical errors and mistakes on the ...
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Sample ghkjkjgkjgkjhgjkgjkgkjgjggkgjkgjkggjggjkgjgjkgjkgjkgjkgjkgjkgjgjgjgjgjkgkgjkgjgkjkgjkjgjgjkgkjkj
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
...were fixed - bonus after you got paid for finding bugs we also pay $5 for system wide(any area on our web site) bugs but only functional bugs with Loom video with Screenshot of the bug with what is expected logically and what you have seen which is a functional bug! not design related bugs only functional. Bug submissions must be completed within 7 days after account approval. We attached sample of bug reporting So you can see correct video and screenshots and text pointing out what is the bug...
I'm seeking a creative professional to design a factsheet on a selected policy's potential impacts on my intersectional identities. The factsheet will be created in Canva and should be engaging, visually appealing, yet comprehensive. Key sections to include: - A deep exploration of the policy's implications on multiple identities, such as being a queer Latinx first-generation college student, an African American businesswoman, or a man of color dealing with student loan debt. Ideal candidates should possess: - Proficiency in Canva or similar design platforms - Experience in creating creative and engaging professional documents - Understanding and sensitivity to intersectional identities and social issues - Ability to succinctly present complex ideas in a visually a...
...sections: 2.1 Healthcare Automation 2.2 WSN in Different Sectors 2.3 WSN in the Healthcare Sector 2.4 Summary Table The summary table must include the following parameters for each paper: Reference Research Objective Methodology Limitation Future Improvement simulator Routing protocol Perf. metric Result 3. Format and Style: • Follow the same format as the attached sample (which is based on a similar study in the agriculture sector). • Ensure the literature review is written in a clear, concise, and academic tone. • Use the Harvard style referencing and mention the citation exactly as the attached document 4. Quality Assurance: • Plagiarism must be less than 10% (verified through tools like Turnitin or Copyscape). &b...
...like you are having a conversation with another person. Recordings without emotion will not be accepted as this is a key requirement. 4. **Sample Work**: To begin, we require a sample of **10 sentences** before signing the contract. This is to verify the recording environment. 5. **Identification**: You must provide proof of your Swedish nationality (e.g., passport, driving license, or student ID). Personal information may be hidden, but the document should confirm your identity. 6. **Payment**: The milestone will be released once we receive feedback on the submission, which will take approximately **15-20 days after submission**. **Note**: In the sample files, we will only check the recording environment, not your accent. So Please apply only if you are a native S...
I'm looking for an experienced Angular developer to build a straightforward application to setup dashboard in Angular. Key Requirements of Proof of Cocept - The app to have navi...Angular developer to build a straightforward application to setup dashboard in Angular. Key Requirements of Proof of Cocept - The app to have navigation bar - Dashboard home page, with widgets - Test data APIs parked at supabase - ability to select / de-select widgets from a list - add selected widget to dashboard - sample charts by using ag-grid charts - you need to use angular material components only Ideal Skills: - Proficient in Angular with a portfolio of similar projects. - Strong understanding and experience with creating interactive charts. - Ability to present complex data in a simp...
...Clean, professional transitions - Optimized for social media platforms ## Project Timeline & Budget - Duration: [Insert your timeline] - Budget Range: [Insert your budget range] - Milestone-based payments ## Application Requirements Please include: 1. Link to your video production portfolio 2. Brief description of your experience with similar projects 3. List of software and equipment you'll use 4. Typical turnaround time for a 2-minute video 5. Sample of a recent video project similar to this scope ## Additional Notes - Regular communication via preferred platform required - Must be able to meet deadlines consistently - NDA may be required - Availability for periodic check-ins and feedback sessions Interested freelancers should respond with their proposals an...
...data. It will automatically generate quotations, and integrate with Odoo for seamless output of quotes, invoices, and processing of payments. Key Functions Include: - Form entry for data collection and processing information to output on a dashboard - Basic calculation functions, primarily for freight cost estimation - Integration with Excel to allow for variable data changes - Imitation of a sample WebApp we have, with additional custom features Data to be Processed: - Customer details - Job request details - Vendor details Ideal Skills: - Proficiency in WebApp development - Experience with Odoo integration - Familiarity with Excel for variable data input - Understanding of basic freight cost calculations Please provide feedback based on this description. We can further disc...
I need a full-stack developer to create a web-only grocery recommendation system using collaborative filtering. The system should have: - User login/signup: Users should be able to create accounts and log in to their personal spaces. - Shopping Cart: Users should be able to add items to a virtual cart for upon adding item it should show recommendations The preferred te...virtual cart for upon adding item it should show recommendations The preferred tech stack for this project is Django and Flask for the backend, with HTML, CSS, and JavaScript for the frontend. Experience with collaborative filtering and e-commerce platforms is a plus. Please only bid if you can deliver a clean, user-friendly interface with efficient backend performance. This is my college project
...mobile-first website for ordering food from my restaurant. The new site should surpass the capabilities of my current website, , and provide an intuitive, efficient ordering experience. Key Requirements: - Use my existing website as a reference to replicate necessary features and options for dish ordering. This includes differentiating between starters and main courses. - Create a sample template mirroring the layout and function of my current site. Proposals that do not include this will be disregarded. - Ensure the site is easy to navigate on all devices, with a focus on mobile usability. - Design a simple, efficient ordering process that minimizes clicks and keeps users on the main page. - Implement dropdown boxes for item options, such as portion size and spice levels...
I'm in need of a PowerPoint slide template tailored for business presentations. The design should embody a professional and corporate st...PowerPoint design. - Prior experience designing corporate presentation templates. - Understanding of professional design aesthetics. Please follow the attached brand colors and design guidelines. Please use standard corporate fonts like Arial or Calibri in the design. Incorporate relevant business icons throughout the template design. Do not include animations. Please use placeholder text in the sample slides. The template should be designed in landscape orientation. Include the ability for the user to add items themselves in the template. Please include technology icons throughout the template design. Use company-related images for the bac...
...engaging, and visually appealing. - Ensure the videos are edited in a vertical aspect ratio (9:16) optimized for social media platforms like Instagram Reels, TikTok, and Facebook Stories. - Add an overlay with the dog’s name, age, and breed in a clean and fun style. - Include simple Valentine’s Day-themed text/image overlays (e.g., “Find Your Furry Valentine,” heart graphics, etc.). We will provide sample messages, but we're open to your ideas. File Delivery: - Provide fully editable project files using Filmora or Adobe After Effects so that I can make minor adjustments in the future if needed Requirements: - Proven experience editing short, engaging videos, preferably for pets/animals or nonprofit organizations. - Ability to work quickly and effici...
As a Site Verifier, you will verify a company’s existence through visual data by conducting a site visit to ensure that we provide reliable and accurate information to our client. JOB DESCRIPTION: • Conduct basic v...goods, etc. REQUIREMENTS: • Must be living in (or nearby) Tianjin, China • Has a camera or phone/tablet of quality with a camera, internet access • Must be available during business hours (9 AM - 4 PM) on working days Please see the attached file for the site visit guidelines. You are only required to deliver the pictures, video & observations and are not expected to assemble a report like the Sample Report. Note: Milestone will be released the following week after the site visit to give us time to organize the report and contact you if...
I'm seeking a skilled web developer to create a website for my service-based business. The primary function of the site will be to facilitate appointment booking for customers. Key Features: - A user-fri...for my service-based business. The primary function of the site will be to facilitate appointment booking for customers. Key Features: - A user-friendly interface that allows customers to easily schedule appointments - Customizable booking forms to gather specific information from customers at the time of booking Ideal Skills: - Proficiency in web development and design/Users/klrboy/Desktop/college project/ - Experience with creating appointment booking systems - Ability to create and implement customizable forms Please share your relevant portfolio and experience when bi...
I need a skilled machine learning expert to train, validate and test a sentiment analysis classification model using BERT, RoBERTa and ModernBERT on Google Cloud Platform (GCP). Key Requirements: - The model will be trained on a sample dataset containing approximately 300k records. - Input data will be provided in a CSV file format. - I have partially labeled data for training and validation, but assistance with labeling may be needed. - The outputs of the model should be shared in an Excel file. - Include detailed data preprocessing steps and techniques. - Define clear performance metrics for evaluating the model, such as accuracy, F1 score, precision, and recall. - Outline the approach for hyperparameter tuning to optimize model performance. - Describe techniques for handling im...
I'm in need of a Canva professional who can transform my content into a sleek, engaging, and visually appealing presentation. The final product should closely mirror the attached sample in terms of style, layout, and quality. Key Responsibilities: • Convert provided content into a well-structured, clean, and captivating 10 to 20 slide presentation • Ensure consistency in design and attention to detail • Deliver the final deck in a quick turnaround time Ideal Skills and Experience: • Strong proficiency in Canva • Proven experience creating high-quality, professional presentations • Portfolio of similar work is highly desirable • Ability to work to tight deadlines without compromising on quality If you have the necessary ...
...retake their photo. - Capture Fingerprint: The application should integrate with a DigitalPersona U.are.U 4500 fingerprint scanner to capture the user’s fingerprint. - Save Data: All captured data (user information, photo, and fingerprint) must be stored securely within the application. - Export to PDF: The application should generate and export a PDF report that contains all the captured data. A sample PDF output is attached for your reference. Ideal candidates for this project should have: - Extensive experience in developing Windows desktop applications. - Knowledge in integrating third-party hardware (like webcam and fingerprint scanners) with applications. - Ability to create secure data storage systems within an application. - Proficiency in generating PDF report...
...like you are having a conversation with another person. Recordings without emotion will not be accepted as this is a key requirement. 4. **Sample Work**: To begin, we require a sample of **10 sentences** before signing the contract. This is to verify the recording environment. 5. **Identification**: You must provide proof of your Norway nationality (e.g., passport, driving license, or student ID). Personal information may be hidden, but the document should confirm your identity. 6. **Payment**: The milestone will be released once we receive feedback on the submission, which will take approximately **15-20 days after submission**. **Note**: In the sample files, we will only check the recording environment, not your accent. So Please apply only if you are a native No...
...like you are having a conversation with another person. Recordings without emotion will not be accepted as this is a key requirement. 4. **Sample Work**: To begin, we require a sample of **10 sentences** before signing the contract. This is to verify the recording environment. 5. **Identification**: You must provide proof of your Denmark nationality (e.g., passport, driving license, or student ID). Personal information may be hidden, but the document should confirm your identity. 6. **Payment**: The milestone will be released once we receive feedback on the submission, which will take approximately **15-20 days after submission**. **Note**: In the sample files, we will only check the recording environment, not your accent. So Please apply only if you are a native D...
I'm seeking a professional video creator to make a brief, sophisticated teaser for my clothing brand. The video will primarily be shared on Instagram, so it needs to be visually engaging and formatted correctly for the platform. I have made a (bad) sample below :)) Key Requirements: - Create a simple, yet captivating script - Incorporate provided photos in an aesthetically pleasing manner - Capture a sophisticated and elegant feel - Convey a message of luxury and exclusivity Skills and Experience: - Prior experience in video creation for Instagram is a must - Ability to create a sophisticated and elegant tone - Excellent script-writing skills - Previous work with luxury brands is a plus
I'm looking for an experienced video editor who can help me edit a social media clip that will be posted on Instagram. Please provide a sample of your previous work that is relevant to this project. If you don't have a specific clip that fits, I'm open to a tailored example that showcases your video editing skills. Ideal skills for this project include: - Proficiency in video editing software (e.g., Adobe Premiere Pro, Final Cut Pro, etc.) - Understanding of Instagram's video requirements and trends - Creative flair for engaging social media content. - Ability to edit and enhance sound quality. The final edited clip should be less than 30 seconds.
...involvement in end-to-end product development in AI/ML projects. Knowledge of data engineering practices and pipeline creation. Familiarity with containerization (Docker, Kubernetes) and continuous integration/continuous deployment (CI/CD) pipelines. Project Details: Duration: [Specify duration or project phase timeline] Budget: [Specify budget range or payment terms] Location: Remote Application Deadline: [Specify deadline if applicable] How to Apply: Interested candidates should submit the following: A detailed resume or CV highlighting relevant projects and experiences. A brief cover letter outlining your approach to AI application development, particularly in leveraging LLMs and GenAI. Links to your GitHub profile, portfolio, or sample projects that dem...
***LONG TERM POSITION AVAILABLE*** We are looking for a skilled 3D Render Artist who can produce high quality renders, with experience in banner design and branding a bonus. The brief is as follows: 1. Create and photo realistic render a controller that matches or improves on the quality of the sample HERE: 2. Create a web banner in size 1920 x 700px using the rendered image(s) you create, with the following text: Line 1 (main text) "10% OFF Personalized Controllers" Line 2 (sub-text) "Using Code 10CMODZ" You have full flexibility in terms of the web banner, You can download all of the model files and textures below: Please see the examples of banners we like the style of (but
I am looking for someone who already has experience with Square and putting it in iOS Apps (I prefer Swift). I have quite a bit of experience but doing Square iOS stuff just frustrates me. I already have an endpoint set up to accept the payment token and all the credentials loaded. I'm just having trouble getting it to work smoothly with credit cards. And the sample app has structure for Apple Pay and I've done the certificate part but I think some code is missing to get Apple Pay to work too. I would like to get both working. Someone who knows Square already would be able to do this quickly because I can do it for web quickly - I'm just not as good with native iOS. here's the quick start iOS App I'm using:
...staging server. - Ultimo is partially installed and functional. Tasks to complete: - Fix multistore setup: One domain is working, but the second domain needs to be set up correctly to point to the corresponding store view. - Adjust host/.htaccess settings as necessary. - Ensure the second store view is fully operational. - Install and configure the Argento theme on the designated store view. - Load sample homepage, footer, and other necessary elements (most of this can be done via CLI). - Verify that only necessary Argento modules are installed. Once setup is complete, we will review and test functionality. Phase 2: Production Implementation Once the staging setup is verified, we will proceed to install the Argento theme on the production server. You will receive access to t...
...origins and family history. - Health Insights: Emphasize the ability to uncover genetic predispositions to health conditions and wellness traits. - Personalized Recommendations: Showcase how GenoConnect provides tailored advice based on genetic data, such as diet, fitness, and lifestyle recommendations. - Ease of Use: Convey the simplicity of the DNA testing process—order a kit, provide a sample, and receive results online. Design Requirements: - Target Audience: The poster should appeal to a broad audience, including individuals curious about their ancestry and those interested in health and wellness. - Visual Style: Clean, modern, and professional with a scientific yet approachable tone. Use visuals like DNA strands, family trees, health icons, or abstract rep...
I need a professional photo editor to create a composite image from several photos of two people and their cats. The end result should have all subjects looking at the camera. I will supply the complete set of raw files. The jpegs attached are just a sample. Requirements: - Combine multiple images into a single composite photo with a consistent background across all subjects - Perform medium retouching on the people and cats, including skin smoothing and detailed adjustments - Return the layered Photoshop file Skills and Experience: - Proficient in Adobe Photoshop - Extensive experience with photo manipulation and composite creation - High-level retouching skills - Previous work with pet and family photos is a plus
I'm seeking a talented 3D interior design/architecture professional to transform a space into a contemporary restaurant and co-working venue. Your portfolio should reflect your capability in handling similar projects with a modern aesthetic. Key Requirements: - Expertise in 3D design software - Previous experience in designing commercial spaces, specifically restaurants and co-working areas - A strong portfolio showcasing modern design elements Please include a sample of your work, particularly any projects that align with this brief, and your rate in INR.
When hiring a freelancer as a reel editor for your product photography shoots, consider the following bullet points to ensure you find a suitable candidate: Skill Set: Proficient in Editing Software: Expertise in Adobe Premiere Pro, Final Cut Pro, or similar editing tools. Experience with Produc...to manage files and meet project needs. Passion for E-commerce or Product Marketing: A genuine interest in product photography and visual marketing can enhance creativity. Problem-Solver: Ability to troubleshoot and find solutions during the editing process. Additional Considerations: Availability for Ongoing Work: Willingness to engage for multiple projects or long-term collaboration. Request for a Test Edit: Willingness to complete a short sample edit to assess skills and fit bef...
...platforms Color and typography guidelines for digital applications Examples of banner design 6. Product Labeling & Packaging Design guidelines for labels and packaging Material recommendations and print specifications Application examples 7. Imagery & Photography Style Defined image styles for websites, social media & print Guidelines on color scheme, composition, and lighting Use of mockups or sample images 8. Icons & Graphic Elements Consistent icons for web, print & labeling Color combinations and size guidelines Pictogram style to complement corporate design 9. Patterns & Textures If my branding includes patterns or textures (e.g., lines, geometric shapes, backgrounds) Application recommendations across different media 10. Web & App Design Gui...
...guidelines. Key Requirements: - Handwriting matching the sample provided to a extend. - Excellent handwriting skills: Your handwriting must be clear, legible, and aesthetically pleasing. - Handwriting samples: You'll need to submit samples of your handwriting for review and selection. - Location: You must be based in Tambaram, Chennai for ease of communication and delivery. Selection Process: - Handwriting Samples: You'll need to submit samples of your handwriting for review. - Writing Samples: I will review your previous project reports. -Final Selection: Based on the quality of your handwriting and writing samples. Deliverables: - Handwritten project reports: These must be written by hand, not typed. - Adherence to Guidelines: The projects must strictly fol...
...submit a sample or more of your past work that demonstrates your ability to render transparent materials effectively. The winner will be chosen based on skill level demonstrated and competitive hourly rate. Prize: The selected artist will be hired for additional work to create high-quality renderings of our product from different angles and positions using an STP file that we will provide. How to Enter: Submit one or more sample renderings of a fairly THICK colorless transparent object (glass, plastic, or similar) that you have rendered based on a STP or STL file. Ensure your submission highlights material transparency, lighting, and product details effectively. Impress us with your rendering skills, and you could become our go-to designer for future work! Please ensure ...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I'm looking for a talented designer to create a detailed 2D floor plan for a one-story residential property. This plan will be used in a full-color brochure, so it needs to be visually appealing and easy to understand. Key Requirements: - The floor plan should highlight the furniture layout in each room. - The design should be suitable for a full-color print broc...each room. - The design should be suitable for a full-color print brochure. Ideal Skills: - Proficiency in 2D design software. - Experience in creating residential floor plans. - Strong understanding of visual design principles for print media. Monochrome floor plan in ready, will send the autocad file upon requirement. Please include examples of similar work in your bid. I have attached a sample image of the o...
I need a sample CBOT for Ctrader with a written tutorial on how to acquire bullish and bearish divergences data from my RSI indicator. The indicator is already set up, so the job will be primarily focused on programming the CBOT and writing the tutorial. I need it to detect and return last divergence condition only and if better I can choose timeframe on cbot for the indicator Ideal Skills: - Ctrader platform proficiency - CBOT programming experience - Technical writing skills Please provide a sample of your previous work with CBOT and written tutorials if available.
I am seeking an editor who can enhance our footage for an upcoming campaign by the Rotaract Club of Ramnarain Ruia College, a non-profit organization in Mumbai. The project involves a series of reels aimed at both raising awareness and promoting an event. Editing Style: - A blend of cinematic and documentary editing techniques will be required to create visually compelling and engaging content. Tone: - The reels should convey an inspirational message. The editing should help to uplift the viewer and instill a sense of hope and motivation. Ideal Skills: - Proficiency in cinematic and documentary editing - Ability to create quick cuts and transitions - Experience with creating content for non-profit organizations - Understanding of how to convey an inspirational message through e...
I have numerous Excel workbooks containing sales data that need to be clea...extract that data at the same time. Do not include this in your price, but if interested chat message about details. The final table should include: - Date of sale - Customer details - Budget costs - Actual costs - Estimated costs - fields for each type of cost on the projects Ideal Skills and Experience: - Proficiency in Excel - Experience in data cleansing and transformation - Ability to handle and process large sets of data - Familiarity with sales data - Attention to detail Attached is a sample workbook "1010" and then a sample final table with the information into the rows of the table, showing only one month but each sheet represents a different month that will have actual,...
We are seeking a talented graphic designer to join our team for various creative projects. The ideal candidate should have a strong portfolio showcasing innovative designs and a keen eye for detail. You will be responsible for creating v isually appealing graphics for print and digital media, collaborating with our marketing team, and delivering high-quality work within deadlines. Proficiency in Adobe Creative Suite and a solid understanding of current design trends are essential. If you are passionate about design and ready to make an impact, we would love to hear from you!
I'm seeking a proficient C# programmer with robust audio programming experience to develop a beat player (see image) as part of an app (Windows and Mac) for songwriters. The beat player will play back sampled drum sounds in a loop, with the rhythm chosen ...Experience in cross-platform application development specifically for Windows and Mac. - Prior experience in audio application development is a significant plus. The application will not include user accounts, real-time notifications, or data synchronization features. However, the ideal candidate will be able to deliver a seamless, efficient and user-friendly audio sample application. Please include links to relevant previous projects in your proposal. The application should feature a minimalist design for an intu...
I'm seeking a professional to produce a 1:30 minute mixed media (both animated and live-action) video ad for me. The video will serve to announce an ...compelling video - Use of mixed media style to engage viewers - Adhere to the tone of being professional and informative Ideal skills and experience: - Previous work in creating mixed media video ads - Strong understanding of how to convey event details in an engaging way - Excellent video editing and animation skills - Ability to deliver within a set timeframe Please refer to the provided link for a sample of the style I'm looking for: The raw content and script can be found here: I look forward to seeing your proposals.
**The Mismanagement and Corruption in UK Government-Funded Projects** Government-funded projects in the UK have long been marred by mismanagement, corruption, and an outrageous waste of taxpayers’ money. While the media focuses on headline-grabbing figures—such as the £100 million spent on a bat tunnel for HS2—the real issue lies deeper. The inefficiency, poorly drafted contracts, and blatant profiteering at every level result in financial losses amounting to billions. ### **Mismanagement in Infrastructure Projects** One of the most shocking examples of mismanagement is the construction of multiple HS2 bridges being installed incorrectly. Reports from industry insiders confirm that at least two or three bridges had to be demolished and rebui...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
Hi Greetings! i can do your thegalleryla website .. i read your project description carefully. please send me all requirement.. will do with interactive and modern look My Process is - 1. i can create a Mockup design using your site requirement like - Site name or Logo, colors, sample site links for structure 2. Wen you finalize design i will do website with Responsive theme .... i have 15 years of experience and done 100's of websites which are running successfully.. can you please get back to me to start the work .. thanks for your time Lalith
...görme vb. istatistikleri görebileceğimiz yapı olmalı. Burayı pazarlama ve eğitim geliştirme ve düzenleme amaçlıda kulllanıyoruz. Dolayısıyla rapolamaya uygun olmalı. Burada acymailing kullanıyoruz bunun gibi raporlaması güçlü bir modülün kurulması. 7) Formların sistem üzerinden takip edilebileceği bir sistem olması. Eğitim talepleri şu an maile geliyor. Maile gelmesi dışında WP içinde müdülden izlenebilmesini istiyoruz. 8) Yeni sitede blog kısmı olacak. Sitede yayınlanacak makaleler hazır. 9) Kişiler eğitimlerin altına yorum yapabilecek ve bunlar onayla yayınlanacak 10) Kurulum sonrası uygulamayla ilgili eğitim verilmesi ufak çaplı sorunlarda ücretsiz destek olunması 11) pazarlama, satış ile ilgili...
I have an excel sheet consisting of about 5000 lines and about 15 columns. The data is a bit random and requires advanced logic to organize. I have added an explanation video and sample excel data sheet to the files. Due to company restrictions, I can't share the excel sheet directly, but I can provide snapshots and detailed descriptions of the tasks and formulas required. Key Responsibilities: - Utilize advanced Excel formula logic to sort data into specific categories. - Implement conditional calculations, data aggregation, and advanced filtering as per the project needs. Ideal Skills and Experience: - Proficiency in advanced Excel is a must. - Prior experience in data sorting and organization. - Strong analytical skills to understand and apply the required logic.
... high-quality solution. Legal / GDPR: The website must comply with German GDPR regulations (Datenschutz, Impressum, Cookie Consent). Files to Include with the Project Description Drafted Site Map or Wireframe (PDF or Sketch) — to clarify website sections and flow. Branding Ideas (if any existing logos, color preferences, or name suggestions). List of Competitors or Reference Sites (if you have sample websites that you like, share them). Preliminary Content (service descriptions, contact info, any text you already have in German/English). Optional: Equipment Brochures (if you want to show the advanced diagnostic tools you plan to feature on the site). Photographs or Workshop Images for the gallery or to illustrate services. (If you do not have some of these files ready, just...
