Employee management system project vb net punët

Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 employee management system project vb net u gjetën punë
    Programing
    Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11629 Average bid
    €11629 Oferta mesatare
    4 ofertat
    Crie um Website
    Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2824 Average bid
    €2824 Oferta mesatare
    1 ofertat

    ...spoken everyday. Availability: ASAP Main responsibilities: The ideal candidate is expected to carry out the following duties both in Russian language: Sales: first point of contact for advices and general enquiries from prospects: what products to buy, prices, offers, quotations, advises on design, colours, sizes, expected delivery times, guarantees, sales policies, etc… Order management: checking clients’ artwork, verifying colours, making graphic files quick fixes and modifications using Photoshop, coordination for the manufacturing and approval of samples Post sales support: helping customers solving problems with deliveries, tracking parcels online (EestiPost, Omniva, DPD, TNT, FedEx, UPS, etc…) handling issues reported by clients with p...

    €15422 Average bid
    €15422 Oferta mesatare
    5 ofertat
    qefqreqweqawdafsc
    Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €190 Average bid
    €190 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb
    Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €109 Average bid
    €109 Oferta mesatare
    1 ofertat

    nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui

    €29 - €240
    €29 - €240
    0 ofertat
    Management System
    Ka përfunduar left

    nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui

    €144 Average bid
    €144 Oferta mesatare
    1 ofertat
    Engaging Social Media Specialist
    6 ditë left
    Të verifikuara

    I'm in need of a dynamic social media expert to engage my followers across LinkedIn, Facebook, Twitter, and Instagram. The primary responsibilities include commenting, creating image and video posts with questions to provoke responses, and developing campaigns to attract pot...wholesalers on LinkedIn. Key Responsibilities: - Create casual and friendly image and video posts designed to provoke responses. - Spend half an hour on weekdays engaging with followers. - Develop campaigns to increase follower engagement and reach potential wholesalers. Ideal Skills and Experience: - Perfect English speaker with a casual and friendly tone. - Proven experience in social media management. - Skilled in creating engaging image and video posts. - Experience in developing successful social m...

    €111 Average bid
    €111 Oferta mesatare
    34 ofertat

    ...- I have admin access to both Harvestapp and HubSpot, so I can facilitate any necessary permissions or settings. Frequency: - The automation needs to operate in real-time or refresh every minute. Ideal Skills and Experience: - Extensive experience with Zapier, Harvestapp, and HubSpot and Webhooks - Strong background in CRM data management. - Excellent problem-solving skills to troubleshoot and optimize the automation as needed. Scope: In this initial project phase we will Use Zapier to: 1) Get Accepted Harvestapp Estimate information a) Estimate Name and b) HRN number (extracted from HRN Harvest app field) 2) Create new deal in hubspot and update this deal with estimate name for deal name and HRN $ amount extracted from HRN number field. Advice: We are looking to s...

    €19 / hr Average bid
    €19 / hr Oferta mesatare
    74 ofertat
    Corporate Event Management a Salerno
    6 ditë left
    Të verifikuara

    I'm in need of a seasoned professional or team for comprehensive planning and coordination of a corporate event. The venue has been secured already, so the focus will be on ensuring the event runs smoothly from start to finish. This project requires: - Extensive experience in event planning and coordination, particularly for corporate functions. - Exceptional organizational skills to manage various aspects of the event. - A proactive approach to problem-solving and ensuring a seamless event experience. Please, only bid if you have demonstrable experience in similar projects.

    €30 - €251
    Lokale
    €30 - €251
    0 ofertat

    I need a quote to build a modern and sleek Shopify website similar to outdoorestore.com.au. The website will need to have 200 products uploaded, and since we will be dropshipping, this needs to be properly set up. Key Features: - A modern and sleek design style - Implementation of custome...200 products uploaded, and since we will be dropshipping, this needs to be properly set up. Key Features: - A modern and sleek design style - Implementation of customer reviews, live chat support, and product recommendations Integrations: - Payment gateways - Email marketing tools - Inventory management systems Ideal skills for this job would include expertise in Shopify, dropshipping setup, web design, and experience with the mentioned third-party integrations. Please provide a quote for thi...

    €278 Average bid
    €278 Oferta mesatare
    157 ofertat

    Are you a creative social media dynamo with an eye for stunning visuals and a knack for engaging storytelling? We’re on the hunt for a freelancer who can take our law firm’s social media presence to the next level! What You’ll Be Doing: Posting 9/10 times a week, for one month, across LinkedIn, Instagram, and Twitter. (We can even discuss paid ad campaigns) Creating a mix of: Short video clips that captivate attention. Carousel posts that tell compelling stories. Link posts that drive engagement. Designing on-brand, professional content using our branding colours (provided). What We’re Looking For: Graphic design skills to make our posts pop. Social media expertise with a deep understanding of platform trends. A passion for creating content that’s infor...

    €441 Average bid
    €441 Oferta mesatare
    118 ofertat

    I'm seeking a talented software engineer to help develop a web app designed for content management, specifically focusing on handling user-generated content. Key Responsibilities: - Design and develop a robust web app. - Implement effective content management features for handling user-generated content. Ideal Skills and Experience: - Proven experience in web app development, with a strong portfolio of content management projects. - Expertise in handling user-generated content within web applications. - Exceptional software engineering skills.

    €20 / hr Average bid
    €20 / hr Oferta mesatare
    84 ofertat

    I need a tailored KSA (Knowledge, Skills, and Abilities) document for a Federal job application targeting a management position. The document should primarily focus on my leadership skills, as this is the key management skill that needs to be highlighted. Ideal Skills and Experience: - Previous experience in writing KSA documents, particularly for federal job applications. - Strong understanding of management roles and the relevant skills. - Excellent writing and communication skills. - Ability to present skills and experiences in a compelling and persuasive manner.

    €105 Average bid
    €105 Oferta mesatare
    40 ofertat

    ...platforms (iOS and Android). The app will provide users with the ability to create fantasy teams, join contests, track live match data, and win rewards. The project will follow Agile methodologies with clear milestones, and the focus will be on cost-effective, high-quality development using open-source technologies. The development is broken into detailed hours for each task and role involved. ________________________________________ Key Features and Functionalities 1. User Registration and Authentication o Secure login via email, mobile, and social media accounts. o OTP-based verification for user security. o Password reset and profile management. o Estimated Hours: 40 hours 2. Fantasy Team Creation o Users can create teams by selecting players within a budget. o Budget t...

    €578 Average bid
    €578 Oferta mesatare
    48 ofertat

    I'm seeking a skilled developer to create a Telegram bot for my online store that accepts Bitcoin (BTC) and Monero (XMR). The bot should facilitate payment processing and provide sales reporting functionalities. Key Requirements: - The bot will primarily serve a cryptocurrency store, hence it must support BT...BTC and XMR transactions. - It should have capabilities for sales reporting to help me track the performance of the store. - The bot should be user-friendly and capable of handling payment processing seamlessly. Ideal Skills and Experience: - Proven experience in developing Telegram bots. - Strong understanding of cryptocurrency transactions, particularly BTC and XMR. - Prior work with store management features and sales reporting systems. - Ability to create user-frien...

    €112 Average bid
    €112 Oferta mesatare
    60 ofertat
    NFC Lost Pet Locator Development
    6 ditë left
    Të verifikuara

    I'm seeking a developer to create a NFC pet tag with a dual-platform management system (Mobile app & Web dashboard). This tag will assist in locating lost pets with the following key features: - Owner-updateable tag details - Sending a text with the finder's phone number - Sending GPS location and a message to the owner Security is paramount, and I require a two-factor authentication system for updating the tag details. Ideal skills for this project include NFC technology, mobile and web development, and experience in creating secure systems. I look forward to your proposals.

    €676 Average bid
    €676 Oferta mesatare
    108 ofertat

    Cross-Platform Real-Time Multiplayer Rummy Game Project Overview We are seeking experienced developers or teams to develop a real-time multiplayer Rummy game compatible with both web and mobile platforms (iOS and Android). The focus is on delivering smooth gameplay, intuitive design, and scalable architecture. The project will follow Agile methodologies to ensure transparency and efficient progress tracking, with regular updates and milestone-based deliverables. Cost-effective solutions using open-source and free technologies will be prioritized without compromising quality. Key Features Real-Time Multiplayer Support Players can join tables and engage in smooth, low-latency gameplay in real time. Cross-Platform Accessibility The game will be fully functional on both web br...

    €490 Average bid
    €490 Oferta mesatare
    27 ofertat

    This document outlines the requirements for developing a widget for ThingsBoard that enables the visualization and management of sensors on a 3D model. The widget will be integrated into ThingsBoard dashboards and will use for 3D graphics management

    €4089 Average bid
    €4089 Oferta mesatare
    35 ofertat

    Project Overview: We are looking to hire an experienced OpenAI developer to help us build a custom content writing tool that will tailor its outputs to the specific writing styles of multiple clients. This tool will use OpenAI's language models (such as GPT-4) to generate content that is in line with the unique writing preferences and tone of each client. The goal is to create a system where, before generating content, users can select a client, and the tool will adjust its writing approach based on predefined client-specific parameters stored in a database. In addition, the tool should be able to learn and adapt its writing style over time by analyzing submitted content, allowing it to better understand and mimic each client’s voice. Since this is my first time ...

    €958 Average bid
    I cilësuar
    €958 Oferta mesatare
    20 ofertat

    This project involves the development of a mobile application that allows users to scan their documents using their mobile devices, save them in PDF or other formats, and print them by sending the files to a printer via Bluetooth. The application will also include ad integration and a subscription system. Project Requirements: Document Scanning and Processing: Scanning documents using the mobile camera. Automatic edge detection and correction functionality. Recognizing and editing text from scanned documents using OCR (Optical Character Recognition) technology. Adjusting color, brightness, and contrast of scanned documents. Merging, splitting, and editing documents at the page level. Saving scanned documents in PDF or image file formats. Document Sharing and Storage...

    €468 Average bid
    €468 Oferta mesatare
    89 ofertat

    ...increase your price later. 2. This is a fixed-cost project. 3. We will make the full payment on completion as we have burnt our hands before as developers were unable to create projects and we wasted time. I'm looking for an expert with ample experience in GitHub and cPanel. The task involves migrating my GitHub project to cPanel, and setting up the necessary configurations and services. Key tasks: - Migrate the Master/Main branch from GitHub to cPanel - Set up SSL and Email configurations on cPanel - Ensure the project runs smoothly post-migration Ideal skills: - Proficient in Git and GitHub - Extensive experience with cPanel - Strong knowledge of SSL setup and Email configuration - Familiarity with basic branch management in Git • I...

    €65 Average bid
    €65 Oferta mesatare
    72 ofertat

    I am in need of an experienced Property Manager to handle the creation and management of property listings . Your role will involve posting accurate, appealing listings, taking photos, writing descriptions, and responding to inquiries. Key Responsibilities: - Post and update property listings on major rental and real estate platforms - Create high-quality photos and descriptions - Respond to inquiries and schedule viewings - Monitor and adjust listings for optimal visibility Ideal Skills and Experience: - Prior experience with property listings and online marketing - Strong communication and organizational skills - Familiarity with real estate platforms and basic marketing

    €33 / hr Average bid
    €33 / hr Oferta mesatare
    34 ofertat

    I...authentication for each user, with shopping cart and robust inventory management system. Knowledge of creating a seamless, secure, and efficient online shopping experience is critical. here is the information: Frontend Development: React.js (18.x) - The core framework used TypeScript - For type-safe development Vite - For build tooling and development server Tailwind CSS - For styling and responsive design Shadcn/UI - For pre-built UI components React Router - For client-side routing Tanstack Query (React Query) - For data fetching and state management Backend Development: Supabase - For backend services including: Authentication Database management (PostgreSQL) File storage Real-time subscriptions SQL - For database queries and management Edge Fu...

    €449 Average bid
    €449 Oferta mesatare
    215 ofertat
    Trophy icon DashPatrol.io Logo Design
    6 ditë left

    I'm looking for a modern, minimalist logo for my software, DashPatrol.io. This software helps users manage their business finances, including email and budgeting, all in one place. ***Follow the color scheme of Key Requirements: - A minimalist style that combines both text and symbols within the logo. - A focus on highlighting the email management aspect of the software. - A design that adheres to the existing color scheme of DashPatrol.io. Ideal Skills: - Strong graphic design and branding experience, with a portfolio of minimalist style designs. - Ability to create a balanced and engaging combination of text and symbols. - Experience with designing logos for software or tech companies would be a plus.

    €29 Average bid
    I garantuar
    €29
    155 kandidaturat

    I'm seeking an experienced Social Media Manager to oversee and enhance my brand's presence o...seeking an experienced Social Media Manager to oversee and enhance my brand's presence on Facebook and Instagram. Your primary responsibilities will include: - Creating engaging, high-quality content in the form of images and videos. - Strategically planning and implementing content to boost our brand visibility and recognition. Ideal candidates should have: - Proven experience in social media management, particularly Facebook and Instagram. - Exceptional skills in content creation, specifically images and videos. - A strong understanding of brand awareness strategies on social media. Please provide examples of previous brands you've managed, as well as content you...

    €17 / hr Average bid
    €17 / hr Oferta mesatare
    87 ofertat

    I am seeking an experienced developer to create an AI-powered voice-ordering system for restaurants. The system should utilize ChatGPT for voice recognition and integrate Azure for STT/TTS services, alongside Twilio for handling phone orders. The primary focus is to design a simple and user-friendly interface for managing orders, without any initial need for POS integration. Additionally, the system will require hardware support for ESP32-based setups, which will be used for microphones and speakers. Key Features: - Voice recognition for both phone and table-based orders. - A straightforward dashboard for order management, or use of ready made like Gloria Food. Ideal Skills and Experience: - Prior experience with AI and voice recognition systems, especi...

    €8236 Average bid
    €8236 Oferta mesatare
    20 ofertat

    Certainly! Here's a more detailed proposal based on your expertise: --- Proposal: Professional Data Entry, Excel Management, and Photo Editing Services As a skilled Data Entry Operator with extensive experience in handling various types of data, I offer fast and accurate data entry services to ensure seamless management of your information. I specialize in organizing and inputting large volumes of data into spreadsheets, databases, and other systems. My ability to maintain consistency and accuracy is crucial for any project that requires timely completion. In addition to data entry, I provide expert Excel management services, specifically for handling protein data. Whether it's for scientific research, dietary tracking, or nutritional analysis, I ...

    €5 / hr Average bid
    €5 / hr Oferta mesatare
    8 ofertat

    I'm seeking a professional who can help me streamline my operations by automating data entry and report generation using ChatGPT integrated with Airtable and Odoo. Key tasks include: - Automating data ent...automating data entry and report generation using ChatGPT integrated with Airtable and Odoo. Key tasks include: - Automating data entries related to suppliers, bids and work orders. - Enhancing efficiency through automation of data entry concerning vendor information and tender offers. This project requires someone with: - Proficient experience with ChatGPT, Airtable, and Odoo. - Skills in data automation and report generation. - Understanding of supply chain, bidding processes and work order management. Please provide previous relevant work examples to help asses...

    €1014 Average bid
    €1014 Oferta mesatare
    109 ofertat
    Infographic-Ready Graphic Designer Needed
    6 ditë left
    Të verifikuara

    ...looking for a talented and creative Graphic Designer to create a professional and contemporary PDF or infographic design showcasing our services. The ideal candidate will have a strong eye for design, excellent technical skills, and the ability to ensure consistency across various content types. You will be responsible for organizing and presenting a range of materials, including social media management portfolios, email handling, lead generation, data entry, graphic design, customer service freelance work, video editing, transcriptions/subtitles, self-introduction audio, certificates, personality tests, CV, and e-commerce projects. Responsibilities: Design a cohesive and visually appealing PDF or infographic. Ensure consistency in design and branding across all materials. Orga...

    €24 Average bid
    €24 Oferta mesatare
    89 ofertat
    super chart bot (personal chatbot)
    6 ditë left
    Të verifikuara

    super chart bot (personal chatbot) chatbot can analysis my screen autonomous select the option on my screen take by given my prompts for exampule when i give the prompt to chart bot write a essay on trump then i want post in my social media post job of chart bot ...select the option on my screen take by given my prompts for exampule when i give the prompt to chart bot write a essay on trump then i want post in my social media post job of chart bot analysis the prompt and search the topic given given prompts then do the all jobs autonomously (showing in chartbot what its doing ) exampule 2 in chart bot >>> i give this prompt build the website water management job chartbot can study the prompt then collect the data for build the website autonomously (showing in chartb...

    €85 Average bid
    €85 Oferta mesatare
    19 ofertat
    Airbnb Virtual Assistant Needed
    6 ditë left
    Të verifikuara

    ...Virtual Assistant Location: Remote (Philippines-based) Company: Premium Short-Term Rental Management (Dubai) About Us:We are a premium short-term rental management company based in Dubai, offering unparalleled service to property owners and guests. Join our dynamic team and play a key role in growing our business! Responsibilities:✅ Handle guest communication professionally and promptly. ✅ Manage calendar, bookings, and dynamic pricing strategies. ✅ Coordinate cleaning and maintenance schedules. ✅ Execute marketing strategies to attract property owners and guests. ✅ Manage and update the company website and social media platforms. ✅ Seek out landlords/clients interested in short-term rental management. ✅ Maintain accurate records and provide regular reporting. Requi...

    €6 / hr Average bid
    €6 / hr Oferta mesatare
    46 ofertat

    I have developed a free licensing platform called Gatekeeper (). It is completely free and also has a telegram bot GatekeeperLicensingBot for on the go notification and license management. I need some help on how can I bring more users to the platform.

    €20 Average bid
    I cilësuar
    €20 Oferta mesatare
    10 ofertat

    I'm looking for a skilled web developer to create a PHP and MySQL based website with 8 pages, featuring a modern and elegant design. The website will primarily serve as a platform for managing financial tables, with data being stored and retrieved from a database. Key Project Requirements: - User Roles: The site will have two levels of user access control: Admin and User roles. - Financial Tables Functionality: Users should be able to add, edit, and delete entries, filter and search data, and generate reports on financial tables. - Data Handling: The site will allow for manual upload of Excel files and exporting data to Excel for further analysis. The pages of the site will include: 1. Categories and Pricing: Displaying items, prices, buyers, sellers, and profit margi...

    €453 Average bid
    €453 Oferta mesatare
    143 ofertat
    Health & Safety Plan for Solar EPC
    6 ditë left
    Të verifikuara

    I am looking for a seasoned professional to create a comprehensive Health & Safety plan and policy for our EPC (Engineering, Procurement, and Construction) company specializing in solar energy. Your plan should specifically target our construction sites. Key components of the plan include: - Risk assessment and management: Identifying potential hazards and strategizing on how to mitigate risks. - Employee training and awareness: Developing training modules to instill safety consciousness amongst our workforce. - Emergency response procedures: Outlining steps to be taken during various emergency scenarios. The primary focus of the Health & Safety policy should be on ensuring our operations are in full compliance with all relevant regulations. Ideal candidates shoul...

    €128 Average bid
    €128 Oferta mesatare
    30 ofertat

    I'm looking to build a dynamic website serving as a blog/content management system primarily hosting videos. The website will need robust search and categorization features for the video content. Ideal skills and experience for the job: - Proficient in developing dynamic, content-driven websites - Strong understanding of video embedding and playback systems - Experience with implementing search and categorization features - Knowledge of designing user-friendly, interactive interfaces - Ability to incorporate SEO-friendly elements for better visibility

    €96 Average bid
    €96 Oferta mesatare
    196 ofertat

    super chart bot (personal chatbot) chatbot can analysis my screen autonomous select the option on my screen take by given my prompts for exampule when i give the prompt to chart bot write a essay on trump then i want post in my social media post job of chart bot ...select the option on my screen take by given my prompts for exampule when i give the prompt to chart bot write a essay on trump then i want post in my social media post job of chart bot analysis the prompt and search the topic given given prompts then do the all jobs autonomously (showing in chartbot what its doing ) exampule 2 in chart bot >>> i give this prompt build the website water management job chartbot can study the prompt then collect the data for build the website autonomously (showing in chartb...

    €81 Average bid
    €81 Oferta mesatare
    13 ofertat

    # everClear - Sales & Inventory Management System ## Core Modules ### 1. Sales Management - **Sales Order Processing** - Customer/Distributor selection - Real-time stock checking - Delivery scheduling - Payment method handling (Cash/Credit) - Invoice generation - CSRF protection and security measures ### 2. Stock Management - **Multi-location Inventory** - Factory stock - Godown stock - Today's production tracking - Stock transfer system - Real-time updates - Automated stock calculations ### 3. Raw Materials - **Material Types** - Preform (12.5g, 19.4g) - Labels (250ml, 500ml, 1000ml) - Capsleeves - LD Shrink - Caps - **Features** - Stock monitoring - Damage reporting - Price calculations - Usage tracking ### 4. Product...

    €300 Average bid
    €300 Oferta mesatare
    37 ofertat
    Bollywood Feature Film AD & Line Producer
    6 ditë left
    Të verifikuara

    ...vibrant city of Mumbai. Key Responsibilities: - Primarily involved in the pre-production phase, laying the groundwork for a smooth shoot. Ideal Candidate: - Must possess an IMDb profile. - Have a minimum of 3 feature films credited in the respective roles. - Experience in scheduling and logistics, with a knack for crew management. - A proven track record of managing budgets and expenses effectively. If you meet the criteria and are ready to be part of an exciting project, please apply!...

    €11245 - €28114
    €11245 - €28114
    0 ofertat

    I need help updating my WordPress blog site. The tasks include: - Installing a new WordPress theme (I have a purchased one) - Updating WordPress to the latest version - Updating all necessary plugins Currently, I'm experiencing an error when trying to update plug...one) - Updating WordPress to the latest version - Updating all necessary plugins Currently, I'm experiencing an error when trying to update plugins, which reads: "cURL error 60: Peer's Certificate issuer is not recognized." This issue needs to be resolved as part of the project. Ideal candidates for this project should have: - Extensive experience with WordPress - Proficiency in troubleshooting WordPress-related issues - Familiarity with installing and configuring WordPress themes - Un...

    €144 Average bid
    €144 Oferta mesatare
    230 ofertat

    I'm looking for a professional developer who can convert a small Visual Basic 6...professional developer who can convert a small Visual Basic 6 (VB6) DLL into a VB.NET DLL. The original VB6 DLL is primarily used for system utilities. It is well-documented, which should make the transition smoother. Key requirements: - Proficient in Visual Basic 6 and VB.NET - Experience in converting DLLs between these two languages - Familiar with system utility programming - Able to work with well-documented code There are no proprietary or third-party dependencies in the original DLL, which simplifies the conversion process. The ideal freelancer for this job will be able to deliver a fully functional VB.NET DLL that mirrors the functionality of the original VB6 system utiliti...

    €169 Average bid
    €169 Oferta mesatare
    24 ofertat

    I'm seeking an experienced AI Engineer or Data Scientist to develop an AI-powered system for optimizing my inventory management process. This system will predict restocking needs based on: - Historical sales data - Current stock levels - Market trends data The primary goals of this project include minimizing stockouts, reducing overstocking, and optimizing inventory costs. While the specific type of AI solution has not been predetermined, I am open to suggestions based on your expertise and experience. A suitable candidate for this project should have: - Extensive experience in AI and Data Science - Proven track record in developing inventory management solutions - Ability to work with various data sources - Excellent understanding of mac...

    €2242 Average bid
    €2242 Oferta mesatare
    71 ofertat

    I'm seeking a dynamic and driven Sales Manager with a focus on lead generation within the tobacco industry. The primary responsibility will be to generate B2B leads, so experience and connections within the tobacco sector will be a significant advantage. Key Responsibilities: - Develop and implement effective lead generation strategies - Identify potential B2B clients within ...Responsibilities: - Develop and implement effective lead generation strategies - Identify potential B2B clients within the tobacco industry - Build and maintain relationships with prospective clients Ideal Skills and Experience: - Proven experience in lead generation, specifically within the tobacco industry - Strong understanding of the B2B sales process - Excellent communication and relationship manage...

    €341 Average bid
    €341 Oferta mesatare
    38 ofertat

    I'm looking for a skilled web developer to upgrade my Loan Management website. The existing site has basic features for borrowers but needs to be enhanced for admin use. Key Requirements: 1. Implement tracking for 'Area' and 'Today's Collection'. 2. Add a comprehensive 'Ledger Management' system. 3. Incorporate several additional features detailed in a document I will provide. Ideal Candidate: - Proficient in HTML and PHP, as the current site is built on these languages. - Able to work within a limited budget and timeline. - Experienced in upgrading admin functionalities on loan management websites. Please Note: The new features will be exclusively for admin access. The 'Area' and 'Today's Collection...

    €304 Average bid
    €304 Oferta mesatare
    45 ofertat

    I am looking for an experienced Senior Data Engineer to join our team. The ideal candidate should have a strong background in data engineering, particularly with the following skills and experiences: - 5+ years in data engineering or related roles. - Master’s degree in Computer Science, Engineering, or a related field is preferred. - Proficiency in Apache Airflow for workflow scheduling and management. - Strong experience with Hadoop ecosystems, including HDFS, MapReduce, and Hive. - Expertise in Apache Spark/Scala for large-scale data processing. - Proficient in Python. - Advanced SQL skills for data analysis and reporting. - Experience with AWS cloud platform is a must. The selected candidate will be responsible for developing data pipelines, managing data warehousing and...

    €1324 Average bid
    €1324 Oferta mesatare
    17 ofertat

    ...a point of contact for clients, addressing inquiries and providing information about products and services. - Follow-Up: Assist in following up with clients to ensure satisfaction and resolve any issues. Data Management - CRM Management**: Maintain and update customer relationship management (CRM) systems with accurate customer and sales data. Reporting Generate and distribute sales reports, including sales forecasts and performance metrics. Sales Support - **Order Processing**: Handle the processing of sales orders, ensuring accuracy and timely delivery. - **Inventory Management**: Coordinate with the inventory team to ensure product availability and manage stock levels. **Coordination and Communication**: - **Team Collaboration**: Work closely with th...

    €17 / hr Average bid
    €17 / hr Oferta mesatare
    19 ofertat

    I'm looking to develop a comprehensive web-based learning management system (LMS), akin to Absorb, designed for creating and managing educational content. This service will be offered to subscribers. Key Features Required: - Course Creation & Management: The system should allow me to create diverse courses, with various content types and formats. - User Progress Tracking: It should track the progress of every user, providing insights into their learning journey. - Subscription Management: A robust system to manage subscriptions, with each 'subscriber' being an entity that can host multiple users. - Entity Management: The system should support managing multiple entities, each with the ability to assign individual p...

    €4001 Average bid
    €4001 Oferta mesatare
    110 ofertat

    ...DONT INCLUDE LIVE EXAMPLES OF PAST WORK: We are seeking a skilled developer or team to design and deploy a high-performance chatbot system capable of handling 10,000 requests per minute. The system will leverage Amazon Web Services (AWS) products to ensure scalability, reliability, and fast response times. Project Requirements: Chatbot Development Develop a chatbot using Amazon Lex for natural language processing (NLP) and conversational AI. Ensure the chatbot integrates seamlessly with backend APIs to provide accurate and real-time information. Multi-channel support (web, mobile, and messaging platforms). Backend Infrastructure: Build a backend system using AWS Lambda (serverless architecture) or Amazon ECS for scalable application hosting. Integrate Am...

    €428 Average bid
    €428 Oferta mesatare
    162 ofertat
    FACEBOOK BUSINESS PAGE MANAGER
    6 ditë left
    Të verifikuara

    I'm looking for a Facebook Business Page Manager who can help me increase engagement on my page. The focus will primarily be on creating and managing video content and text posts. Key Responsibilities: - Develop and post engaging video content and text posts - Manage interactions on the page to foster a sense of community Ideal Skills: - Proven experience with Facebook Business Page management - Strong understanding of content that drives engagement on Facebook - Ability to create engaging video content The tone of the content should be casual, so a knack for creating relatable, easy-going content will be key. Looking forward to working with someone who can help me take my Facebook presence to the next level!

    €17 / hr Average bid
    €17 / hr Oferta mesatare
    79 ofertat

    I HAVE CODE IN TEXT FILE - BUT ALSO HAVE GITHUB. So this is testing and troubleshooting I'm developing a Flutter app that will use native IOS AVFoundation for camera code. Below are the items i'm looking to add to my Existing starter project. Looking for someone to collaborate with me closely on the project. 1. **Video Capture** - **AVCaptureSession**: Use `AVCaptureSession` to manage the flow of data from input devices (like the camera) to outputs. - **AVCaptureDevice**: Select and configure the camera as the input device. - **AVCaptureVideoDataOutput**: This output allows you to access each frame of video data as it's captured. You can use a delegate method to process each frame. 2. **Buffering Frames with DispatchQueue** - **CMSampleBuffer**: Each frame...

    €152 Average bid
    €152 Oferta mesatare
    34 ofertat