Crystal report vb net punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
...book across various platforms. The goal is to increase the book's visibility, garner more reviews, and ultimately, expand its readership. Key Responsibilities: - Implement innovative and effective social media marketing strategies on Facebook, Instagram, Twitter, and potentially other platforms. - Engage with followers and potential readers to build a community around the book. - Monitor and report on the book's social media performance. Ideal Skills: - Proven experience in social media marketing, particularly for book promotion. - Excellent communication skills to interact with the online community. - Ability to create engaging content to captivate readers. - Proficiency in using social media analysis tools to track performance and adjust strategies accordingly. I ...
I'm looking for a professional who can assist me in identifying the ideal customer pool for my food ingredients solution, specifically aimed at packaged food manufacturers. The project will entail comprehensive market mapping, data analysis, and the creation of an insightful report. Key Tasks: - Identifying the right customer pool in the packaged food manufacturing industry. - Analyzing data on consumer preferences and trends, competitor activity, and the overall market size and potential. - Producing a detailed report that encapsulates the findings of the analysis. Ideal Candidate: - Proven experience in market analysis, preferably within the food industry. - Strong data analysis skills. - Ability to create comprehensive and clear reports. - Understanding of consumer ...
...modernizing the tech stack, fixing bugs, improving the payment funnel, and enhancing the front-end UI for a sleek, user-friendly experience. Additionally, I need back-end API development to support future front-ends and application integrations, along with the introduction of a freemium-to-paid content model, Stripe integration, and SEO optimization. Key Deliverables: Platform Upgrades: Update .NET and Angular frameworks for better performance and reliability, with bug-free functionality. Back-End API Development: Develop a robust and scalable back-end API that can be used for future front-ends and third-party application integrations. Freemium Model & Paywalls: Implement a freemium model displaying 30% of each content for free, with the remaining content locked behind a pa...
I'm looking for someone with a strong understanding of computer networks who can help me in wirting report addressing network performance issues. The report should identify potential business implications, and propose possible solutions. Ideal skills and experience: - Proficient knowledge in computer networking - Experience with writing business reports - Ability to identify and solve network-related issues
...with high urgency, focused on selling large quantities in a short period. Key Responsibilities: Develop and manage Meta ad campaigns to drive fast sales for our products. Target the right audiences to ensure products are seen by customers who need them. Create ads that emphasize urgency and scarcity (e.g., “Limited Stock”). Optimize campaigns quickly based on data to ensure the best possible ROI. Report on campaign performance and adjust accordingly to maximize sales. What We Offer: Trial Period: We’re offering a 7-10 day trial to test your ability to generate quick sales. If you deliver results, we will offer you a permanent position. Unlimited Product Potential: We regularly receive new products in large quantities and will continue to offer you opportunities...
I'm in need of a skilled social media professional who can help with monthly posts and account handling across various platforms. Key Requirements: - Expertise in Facebook, Instagram, WhatsApp, Googl...LinkedIn - Proficient in creating engaging posts for Facebook, Instagram, and LinkedIn - Experienced in managing ads across these platforms - Ability to strategize for maximum reach and engagement Skills and Experience: - Proven track record in social media management - Excellent content creation skills - Strong understanding of social media algorithms and advertising - Ability to analyze and report on social media performance I need someone who can not only create posts but also manage ads on these platforms. The goal is to optimize my social media presence and enhance my br...
...teams. Email: Add email templates, send notifications, and configure recipients. Task: Create tasks with: Title and description. Multiple outcomes (e.g., complete, pending, etc.). Assignment to teams or admins. Notification emails, task expiration, and reminders. Approval & Sign: Configure approvals with signatures. Approval: General approval flows. Team Approval: Multi-level team approvals. Flow Report: Generate workflow reports. PDF & Sign Documents: Generate, manage, and sign PDF documents. Logic Elements: If/Else Conditions: Add conditional logic for workflow branching. Conditional Branch: Dynamically route based on conditions. Split Branches: Create parallel workflow paths. Merge Branches: Combine branches back into a single flow. End: Define workflow termination po...
As discussed in the chat, create a report template today.
Job description Position: Political Diplomatic Analysis Consultant About RCSS The Regional Centre for Strategic Studies (RCSS) is a South Asian regional think tank, based in Colombo, Sri Lanka. Established in 1992, it is an independent, non-p...options Location: Remote Your Work, Your Way: We call our hybrid working vRCSSon RCSS Works. And it does. We trust you to make the right choices around where, when and how. Employee Benefit: •After probation, a basis of $250 and up to $450 dollars for each report of high pay grade could be discussed in the interview according to employee's position an professional experience. •A feasible working pattern of $1000-$3000 monthly salary and bonus for each report •Travel around the world for work or rewards •Bon...
...Ads (limited use of Google Analytics currently). Plan to integrate videos across landing and home pages for trust-building and conversion optimization. Deliverables Expected: -Answer all numbered items. -All items shall be discussed and the WHY should be detailed. The scientific evidence, if possible, behind shall be brought forward. -Use analytical tools to prove your point (and share the report). -The service and treatments category on inovoaesthetics and inovomedical as well as the general structure should be detailed precisely. (This is the way I will determine if you are truly interested to learn about our services and to find the best solution). Proposed content organization model that balances user needs with SEO best practices -I need to know what WordPress tools yo...
I need an Excel report that handles financial data, including expense tracking, revenue generation, and profit and loss analysis. The report needs to have interactive features such as pivot tables and interactive charts. Ideal Skills: - Proficiency in Excel, particularly with pivot tables and creating interactive charts - Experience working with financial data - Ability to create comprehensive and easy-to-understand Excel reports
My company has been...Patience is very important for this job. You must be patient with the students and parents, and be respectful while maintaining the school's integrity. Key Responsibilities: - Manage email and other communication channels - I will create a school email for you that you will use - Handle sales inquiries, call-backs, verification of sales, preparation of certain documents like receipts, invoices, report cards - Provide customer service support over the phone - Conduct verification calls and emails Ideal Skills and Experience: - Prior experience in customer service, particularly phone support - Excellent communication skills - Sales experience is a plus - Proficient in handling emails and other forms of communication - Capable of conducting verification c...
...import/export restrictions and regulations. Cost Analysis: Detailed calculation of costs from sourcing, shipping, and marketing to operational expenses. Insights into profitability and feasibility of the business model. References: Please check websites like Silkrute for an idea of what I am aiming to achieve. Deliverables: A detailed business plan addressing the above requirements. A cost analysis report with recommendations for minimizing expenses. A clear roadmap for setting up the store and handling operational challenges. Additional Details: I will handle some aspects myself but need guidance on critical components. The consultant will be required to help with initial paperwork and ensure smooth implementation. Provide recommendations on tools or platforms (e.g., shipping...
I need a professional and formal redesign of a report template for client presentations. The template is based off an example report I will provide. - Copywriting and logo will be provided - Layout structure, color scheme and fonts from the example report are all up for discussion - Ideally, you have experience in corporate design and can help me create a template that is visually appealing and communicates the right message Please be aware that this is a time-sensitive project and I need the redesigned template today. Your ability to deliver on time and your understanding of corporate design will be key to a successful collaboration.
...their earnings based on their token ownership. 3. Ownership Representation: The range of 0 to 1 billion SHE tokens should correspond to 0-100% ownership shares. 4. Label Update: Change the label to “SHE Tokens Owned” instead of “Ownership Shares Selected.” RIGHT SLIDER: 1. Net Profit Range: Set the range from 50k to 10 billion. 2. Manual Entry: Allow users to manually enter their net profit as well. 3. Slider Adjustment: Ensure the slider toggle adjusts according to the manual input field. 4. Rename to “SHE future net profits” Design Changes: - Update the background images in the circles to feature our SHE coin logo and the logos of the exchanges only. Staking Information: - Retain the staked toggle with the following details. ...
...Zoho Page Sense for my websites: and An existing project is already set up for inovoaesthetics.ca. The main tasks include: - Conducting heat map analysis on most or all pages and landing pages of the above sites, including inovoaesthetics.ca. - Implementing strategic cross-domain tracking while individually monitoring each site. - Generating a detailed report on additional settings and developments that would enhance our website tracking and overall development. In terms of heat map analysis, please include: - Homepage - Contact Us page - Service/Product pages - Forms For tracking, I want to monitor: - Button clicks - Form submissions - Page scroll depth - Any other significant events The ultimate goal is to understand: - User navigation patterns
...looking for a seasoned digital marketer to boost my book sales through a targeted social media campaign. Key Responsibilities: - Develop and execute a comprehensive social media marketing strategy across platforms including Facebook, Instagram, Twitter, and TikTok. - Create engaging content aimed at driving sales, increasing visibility, and reaching potential readers. - Monitor, analyze and report on the effectiveness of the campaign with a focus on sales performance. Ideal Candidate: - Proven experience in digital marketing, particularly in promoting books or authors. - Excellent understanding of various social media platforms and their marketing tools. - Outstanding content creation skills, with a knack for engaging diverse audiences. - Strong analytical skills with the ab...
Job Summary: We are seeking talented Full Stack .NET Developers to join our team. This is a flexible opportunity, with both full-time and part-time positions available, designed to cater to professionals with varied availability. As a developer, you will contribute to building and maintaining robust, scalable, and high-performing web and desktop applications using the latest .NET technologies. Responsibilities: Back-End Development: Develop and maintain server-side components using C# and ASP.NET Core. Design APIs (RESTful or gRPC) for seamless front-end integration. Work with Entity Framework and databases such as SQL Server or SQLite for efficient data management. Ensure secure and scalable solutions through best practices in cryptography and system architecture. Front-En...
I will write a professional report task in less than 12 hours.
Writing a report for case study as the guidelines document
...Customer Table Booking: A user-friendly interface for customers to book tables. - Admin Dashboard: This should include features for managing bookings, overseeing sales reports, and having an overview of table availability. - Availability Check: The system should be able to check the availability of tables in real-time. - Booking History: Keeping track of past bookings for future references. - Sales Report: Generating reports based on sales data. - Simple Design: The design should be uncomplicated, focusing on smooth functionality and effective table management. Moreover, customers should receive booking confirmations via SMS. Ideal candidates for this project should have: - Extensive experience with Laravel - Previous work on restaurant booking systems or similar projects - S...
I own a piece of land in Andorra, specifically at Ruta d’Engolaster, Escaldes Engordany, No. 7-17, measuring 11,507 square meters. I'm seeking a professional to assess its current market value. The land is currently vacant with no existing structures or developments on it. Key Requirements: - Professional land valuation - Mark...specifically at Ruta d’Engolaster, Escaldes Engordany, No. 7-17, measuring 11,507 square meters. I'm seeking a professional to assess its current market value. The land is currently vacant with no existing structures or developments on it. Key Requirements: - Professional land valuation - Market value assessment Please note, at this stage, I'm only looking for an estimate, rather than a detailed report. Your expertise in this ...
I need an expert who can help me streamline some complicated spreadsheets. The focus will be on creating comprehensive financial reports. The reports should cover revenue and expenses. Ideal Skills and Experience: - Proficiency in Excel or Google Sheets - Experience in financial analysis - Report generation expertise - Attention to detail - Ability to simplify complex data
I am seeking a specialist in Facebook lead generation to help me in the technology sector. The objective is to generate quality leads that can potentially convert into clients or customers. Key Responsibilities: - Develop and implement effective lead generation strategies on Facebook - Identify and target potential leads within the tech industry - Monitor and report on the success of lead generation campaigns Ideal Skills and Experience: - Proven experience in lead generation, particularly on Facebook - Strong understanding of the technology industry - Excellent communication and analytical skills
We are seeking a skilled freelancer to help transfer and configure macros from one computer to another. The macros are fully operational on the original machine, and we need assistance ensuring they work seamlessly on the new setup. Ideal skills and experience for the job include: - Proficiency in Excel, specifically with macro creation and implementation. - Experience with data manipulation, report generation and task automation. - Ability to troubleshoot and optimize existing macros for efficiency.
I'm looking for a skilled developer to create a SketchUp plugin that automates my workflow, specifically focusing on generating material reports. Key Requirements: - Expertise in SketchUp plugin development - Prior experience with workflow automation solutions - Ability to implement report generation functionality Ideal Skills: - Proficient in Ruby (SketchUp's programming language) - Strong understanding of material reporting within SketchUp - Experience in software development and automation tools Please provide examples of similar projects you've completed in the past.
I need a professional Word template for research reports. It should follow a standard business format. Ideal skills for this project include: - Proficiency in Microsoft Word - Experience with creating document templates - Understanding of standard business report formatting - Knowledge of how to structure a research report Your past work should demonstrate your ability to create a user-friendly, professional document template. Please include examples of similar projects you've completed.
I'm looking for an experienced app developer to create an iOS and Android app that allows users to generate PDF reports based on their inputs. Features: - The app should collect user inputs through text entries, file uploads, and form submissions. - The PDF reports should be generated using predefined templates. Idea...allows users to generate PDF reports based on their inputs. Features: - The app should collect user inputs through text entries, file uploads, and form submissions. - The PDF reports should be generated using predefined templates. Ideal Skills: - Proficiency in iOS and Android app development. - Experience in creating apps that generate PDF reports. - Prior work with predefined templates for report generation. Please provide examples of similar projects yo...
...and services offered on fofeni.com. Implement SEO best practices to improve both organic and paid traffic for the website. Regularly optimize landing pages for conversion rate improvement. Set up and manage Google Analytics to track and report on traffic, clicks, conversions, and ROI. Ad Copywriting & A/B Testing: Write compelling ad copy that resonates with pet owners and leads to higher click-through rates (CTR). Conduct A/B testing on ads to find the best-performing headlines and descriptions. Performance Reporting: Regularly track, measure, and report on the performance of the Google Ads campaigns. Adjust budget allocation and bidding strategies to maximize ROI. Provide insights on campaign performance, including click-through rates, conversion rates, and cost-pe...
I need my ASP.NET Core 6.0 Razor web app upgraded to .NET 8. All its third-party NuGet packages must be updated as well. The upgraded system should compile and run smoothly on my computer without any errors. Code is here: *** your bid is your bid and not a placeholder, if you cannot do that, then do not apply
...factors. Organize and update lead databases, ensuring the information is current and actionable. Collaborate with the sales and marketing teams to ensure the leads align with overall strategies. Use various outreach methods (email, phone, social media) to initiate contact with leads as necessary. Continuously analyze and optimize lead generation processes to improve efficiency and results. Track and report on lead generation activities and key performance metrics. Requirements: Proven experience in lead generation, list building, or similar roles. Strong knowledge of lead generation tools (e.g., LinkedIn Sales Navigator, , ZoomInfo, etc.). Excellent research and data entry skills, with attention to detail. Ability to work independently and as part of a team. Familiarity with CRM...
I'm looking for a detailed dental smile analysis smile to identify any cosmetic issues. Key Focus Areas: - Teeth Alignment: Assessment of whether teeth are properly aligned. - Teeth Coloring: Evaluation of the color of teeth and any potential discoloration. - Teeth ...identify any cosmetic issues. Key Focus Areas: - Teeth Alignment: Assessment of whether teeth are properly aligned. - Teeth Coloring: Evaluation of the color of teeth and any potential discoloration. - Teeth Shape/Size: Examination of the shape and size of teeth. Deliverable: - I would like to receive a detailed report outlining your findings, including any cosmetic issues you identify. Ideal Skills and Experience: - Dental background preferred - Experience in cosmetic dentistry - Report writing skill...
I'm looking for a skilled PHP developer to implement a new feature in my system that generates sales reports in PDF format. The reports should include total sales, individual item sales, and sales by predefined periods like last week or last month.
...(ADX). Key functionalities of the script include: - Signal generation: The script should be able to identify trading signals based on the MTF RSI and ADX indicators. - Automated trading execution: Upon the generation of a signal, the script should automatically execute the trade on CoinDCX. - Performance tracking and reporting: The script should monitor the performance of the trades and generate a report for review. The script needs to be compatible with Windows operating system. I have a preference for the following Python libraries: - Pandas: For data manipulation and analysis. - NumPy: For numerical computations. - TA-Lib: For technical analysis of financial market data. I am looking for someone who can deliver a robust and efficient script that meets these requirements. ...
I'm preparing for a civil case and need assistance researching relevant Florida Statutes. The ideal freelancer for this project should have a strong background in statute law, particularly in Florida, and experience in legal research for civil cases. Key tasks will include: - Identifying and interpreting relevant Florida Statutes - Providing a detailed report of findings - Offering insights on the potential impact of these statutes on the case
I am seeking an experienced AI/ML developer to create a Python-based predictive analytics model for structured data. The model will be primarily focused o...predictive analytics model for structured data. The model will be primarily focused on classification tasks, similar to spam detection. Key Tasks: - Full data preprocessing: The data is not prepared for use, and comprehensive preprocessing will be required. - Feature selection - Model training - Performance evaluation using TensorFlow/PyTorch Deliverables: - A trained model - A detailed performance report - API integration Skills Required: - Proficiency in Python - AI/ML expertise - Experience with TensorFlow and PyTorch - Strong data analysis skills The project budget is between $500 to $1,000, with a completion timeline o...
I'm looking for a proficient Data Analyst to assist with generating reports based on our sales data. Key Responsibilities: - Analyze sales data to create comprehensive reports Ideal Skills: - Proficiency in Excel is a must - Previous experience with sales data is preferred - Strong analytical skills - Excellent report writing abilities
I need a professionally designed PowerPoint presentation (approx 40 slides) for a qualitative research project focused on the customer journey from the first stage of need to awareness, evaluation and decision making. I am looking for creativity in visually communicating the story we are writing and a visually compelling journey map and slides from interviews conducted as part of the res...research. All content will be written and provided to the designer. Ideal skills and experience include: - Proficiency in creating engaging and professional PowerPoint presentations. - Experience with qualitative research and understanding of designing a customer journey map. - Ability to present data in an engaging and accessible way to our audience. - Designing or customizing icons for use in the r...
I'm seeking a professional designer to create the cover page for our annual report at HLL Lifecare Ltd. The design should be clean, sophisticated, and in line with a professional style. It should incorporate the following elements: - Our company logo - The report title - The year of the report - An image that encapsulates the vision of HLL In terms of color scheme, I'd like the design to use neutral tones. Ideally, you should have experience in corporate design and a strong portfolio of similar projects.
Job Title: Financial Data Analyst for Company Valuation (Equity Sale) Description: I am the owner of a private company, and I am looking for an experienced Financial Data Analyst to provide a detailed valuation report for a portion of the company I intend to sell. The goal of this report is to determine the market value of the company and calculate the value of the specific equity stake that I am looking to sell. Scope of Work: 1. Review of Financial Statements: • Analyze the company’s financial data, including the balance sheet, income statement, and cash flow statement for the last 2-3 years. • Provide a summary of key financial metrics and performance indicators. 2. Valuation of the Entire Company: • Determine the overall market value of the com...
Hello, I'm seeking a Windows application to analyze and report data from my notepad server logs. The main focus will be on the health status logs. Here are the specifics: - Data to be Analyzed: Primarily, I need the application show the status of server disk health. - Current Log Format: i can get report from my server and put it in the folder. The health status logs are currently in plain text format. -Metrics to Track: The application should specifically monitor and report on Disk Health metrics from these logs. Ideal candidates for this project should have experience in Windows application development and data analysis. Familiarity with server log analysis would be a significant advantage. Must b build using python,
I'm looking for a skilled mobile app developer to create a daily expense tracking app specifically for Android. This app should help me track my da...app developer to create a daily expense tracking app specifically for Android. This app should help me track my daily expenses and ultimately help me understand how to earn back what I spend. Key Responsibilities: - Develop a user-friendly, intuitive Android mobile app - Implement functionalities including report generation Ideal Skills: - Strong experience in Android app development - Previous work with expense tracking apps is a plus - Good understanding of data visualization for report generation Please note, the app does not need to support expense categorization or budget alerts, but should be capable of generating ...
...addresses). • Ensure data accuracy and relevancy. Qualifications: • Proven experience in market research or business consultancy in UAE • Familiarity with African business networks or diaspora communities, especially in UAE. • Strong organizational and analytical skills. Deliverables: • A comprehensive and well-organized directory in an editable format (e.g., Excel, Google Sheets). • A short summary report of the research process and insights gained during the project. Additional Information: • Preference will be given to candidates familiar with Dubai’s African community or with access to existing networks. • Please include examples of previous relevant projects or research in your proposal. Budget: This is an initial research p...
I'm in need of a seasoned .NET developer with expertise in Angular 16 for the development of a comprehensive HR Management System (HRMS). This system will be built on .NET Core and will incorporate several key HR modules, including: - Payroll Management - Employee Self-Service - Recruitment Management The ideal freelancer for this job should have a robust understanding of both .NET Core and Angular 16. Previous experience in HRMS development is highly desirable, as is a strong portfolio demonstrating successful .NET and Angular projects. Your ability to create user-friendly interfaces and efficient back-end systems will be critical to the success of this project.