Convert vb6 to vb.net visual studio 2017 punët
...e em demanda que se alinham com as tendências atuais do mercado. - Desenvolvimento de Estratégia: Criação de um plano claro de marketing de afiliados focado em plataformas de mídia social, como Instagram e Facebook. - Seleção de Produtos: Ajuda na escolha de produtos agrícolas para promover, levando em conta minha falta de experiência na área. - Criação de Conteúdo: Desenvolvimento de conteúdo visual e escrito otimizado para as redes sociais, a fim de atrair e engajar o público-alvo. - Estratégias de Divulgação: Implementação de estratégias para aumentar a visibilidade e o alcance das publicações nas redes sociais. - Acompa...
email me asap email me asap email me asap email me asap email me asap email me asap email me asap email me asap email me asap email me asap email me asap email me asap
email me asap email me asap email me asap email me asap email me asap email me asap email me asap email me asap email me asap email me asap email me asap email me asap
Eshte nje projekt super i bukur nga donald bukuroshi
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
Graphic design, also known as communication design, is the art and practice of planning and projecting ideas and experiences with visual and textual content.
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
I need a formal and professional PowerPoint presentation that serves as an introduction to my company, which specializes in Incorporation & Company Secretary services in Singapore. Key requirements: - The main focus of the presentation should be on the 'Services Offered' by the company. - The presentation should adhere to a formal and professional style, suitable for corporate audiences. - The designer should have a strong understanding of what a corporate PowerPoint presentation should look like, with a focus on clarity, conciseness, and visual appeal. Ideal skills and experiences: - Proven experience in creating corporate presentations. - Exceptional PowerPoint skills. - Strong understanding of corporate language and tone. - Experience in the Incorpo...
We are looking for an experienced developer to set up, customize, and deploy our newly purchased white-label taxi app, Droptaxi 2.2, along with its admin dashboard. The developer must be proficient in: Setting up and configuring Droptaxi on a Linux VPS (Ubuntu 22.04). Configuring Google APIs (Maps, Firebase, etc.). Customizing the app and admin dashboard branding (colors, logos, and icons). Deploying the apps to Google Play Store and Apple App Store. Tasks Include: App Setup: Complete installation and configuration of Droptaxi 2.2 on our Linux VPS. Set up all dependencies, including Node.js, Cordova, JDK 17, Gradle 8.7, and Android Studio. Configure Firebase for cloud messaging and phone authentication. Dashboard Setup: Install and configure the admin dashboard. E...
...of cabin crew performance. During my career, I developed a strong foundation in team management, organizational skills, communication, and problem-solving. I am now transitioning into the world of virtual assistance, leveraging my experience and commitment to helping businesses thrive. Top Skills and Strengths Leadership: With decades of experience managing teams in high-pressure environments, I’m adept at making quick decisions, coordinating resources, and ensuring smooth operations. Organization: My background has sharpened my ability to stay highly organized, prioritize tasks, and manage multiple responsibilities efficiently. Communication: As a supervisor, I’ve honed my skills in both verbal and written communication, ensuring clarity and transparency acro...
I'm looking for a professional Visual Fox Pro developer to upgrade our service company's software. The priority is the Quotation and Invoicing module, followed by enhancements to the Purchase Order features. Key requirements include: - Upgrading the Quotation and Invoicing module with user interface updates - Adding additional features to the Purchase Order module - Improving the overall usability and efficiency of the software Please note, my budget for this project is $200 USD. If you're able to meet this requirement, I look forward to your bid. If not, please don't waste your time and mine. Please check the video as well Wishing you a prosperous New Year and happy bidding!
I need a professional translator to convert an approximately 800-page Marathi chargesheet into English. This translation is critical for legal proceedings, so it must be accurate and clear. Key Details: - The document is roughly 800 pages long. - Standard legal terms are used throughout the document, so a translator with a strong understanding of common legal jargon will be beneficial. - The translation does not need to be certified, but it does need to be of a high quality suitable for legal review. Ideal candidates for this project should: - Have extensive experience in translation from Marathi to English. - Be familiar with legal terminology and documents. - Be able to deliver a meticulous and high-quality translation within a reasonable time...
I'm looking for a skilled audio-visual professional to help me create a 30-second commercial that promotes brand awareness. This project is time-sensitive and needs to be completed by Friday, January 3rd. - B-Roll Video, Audio, and Graphics: I will provide all necessary B-Roll video, audio, and graphics. Your role will be to creatively piece these elements together into a compelling commercial. - Target Audience: This commercial needs to resonate with all demographics. An understanding of how to appeal to a wide audience is essential. - Tone: The commercial should have an energetic and exciting tone. Your ability to inject a sense of enthusiasm and vitality into the piece will be key. Ideal candidates will have experience in...
I'm seeking a Python expert to help debug and enhance my stock trading algorithms. I provide the logic, you convert it to code and integrate with my trader's API. My current strategy, initially successful, is now throwing errors I can't resolve. I need someone to: - Debug and improve my existing code, primarily focusing on error handling. wsp 9190481111zero8, I'm keen to collaborate on future strategies if this initial project goes well. Strong Python skills and experience with trader APIs are essential.
I'm seeking an expert to set up a comprehensive YNAB system for me that will allow for both personal and professional budget management. Key Requirements: 1. Complete YNAB Setup: - Incorporate my 3 personal accounts and 1 joint account with my wife. - Create budget categories for all personal and professional expenses, particularly for setup costs and ongoing costs. 2. Transaction Import Setup: - Convert my 3 months of bank statements from PDFs into YNAB-compatible CSV files. - Import all transactions and demonstrate how to do this for future statements. 3. Automation for Recurring Expenses: - Categorize recurring transactions (like rent and utilities) so YNAB learns them for future imports. - Provide recommendations for any other useful sof...
I got more sales with Google search. As we are good in service and good with people many customers posted a positive review in Google Maps. Really it helps our business. But If I went to nearby area and if I search stationery in Google. It will appear on 10th - 20th line. I need to someone work for this and need to top Aysha Stationery and Gift Trading. So it will increase my retail sales and customer will call us directly for any enquiries. So we can convert the customers into sales.
...talented 2D Animator to join our team for an exciting long-term project creating sports-themed animations for our YouTube channel. Project Details: - Output: 4-5 animated videos per month, each around 6 minutes long. - Shorts Content: Create 3-5 short clips from each main video for broader reach. - Compensation: $50 per video, with potential increases based on video performance metrics. - Collaboration: Ongoing engagement to maintain a consistent workflow. Reference Channels for Style: @FWorld86 @FDOR Responsibilities: -Storyboarding: Create storyboards to outline the narrative. -Character Design: Develop engaging and unique characters for sports animations. -Animation: Deliver dynamic and fluid animations that bring stories to life. -Video Editing:
I'm seeking skilled full stack developers to create a comprehensive SaaS product. This project entails both web and mobile interfaces, with the mobile app designed to cater to both iOS and Android platforms. Key Features: The SaaS product will encompass 7 key modules - (1) My Dashboard module, (2) Safety module, (3) People module, (4) Asset module, (5) Work Management module, (6) Procurement module, and (7) adhoc Reports module. Each module will have unique features, such as AI bot integration and editable tables. Technical Requirements: Option 1: - Web Architecture using Microservices - Frontend development with Html/CSS/TypeScript/React - Backend development with Java Spring Boot - Database management with MySql - Mobile development using Flutter Option 2...
I need a VFX expert to recreate a car jumping out of the screen, similar to my reference video. This is intended for social media content, so it needs to be engaging and shareable. NEED: Blender files, rendered video donot need the arrow falling effects. only car. RAw2 is the footage to be used. at 29.9fps budget is 40$ fixed Key Requirements: - Ability to create realistic visual effects - Experience with video compositing - Ability to replicate a specific reference video The ideal freelancer for this project would have a strong portfolio in VFX, particularly with realistic effects, and experience creating content for social media. Please be prepared to discuss and showcase your relevant work.
I'm in need of a skilled animator who can create simple transitions within an SVG. The primary aim of this animation is for visual storytelling, so the ability to convey a narrative through movement is crucial. Key Requirements: - Expertise in SVG animation - Ability to create simple transitions - Experience in visual storytelling through animation - Strong understanding of minimalistic design style Please, only apply if you can deliver a clean, minimalistic animation that captivates and tells a story.
I need a Python script that utilizes Optical Character Recognition (OCR) to convert images into text. The images I will provide have a consistent format and contain structured data similar to tables. Key Requirements: - The converted texts must be stored in a MySQL database. - The texts should be saved in a table called 'plates' with five columns: id, text1, text2, text3, and text4. Each generated text from the image should occupy one of these columns. Ideal skills for this job include: - Strong proficiency in Python, particularly in image processing and OCR libraries. - Experience with MySQL and Python's database connectivity. - Ability to write clean, efficient, and well-documented code.
I'm seeking an experienced video editor for fast-paced, tech-focused shorts. The videos should have quick cuts, engaging text overlays, smooth transitions, and visually appealing animations. Ideal freelancer should: - Have a solid understanding of tech and gadgets content - Be able to deliver a fast-paced editing style - Have experience with creating and integrating visual effects - Be creative with the use of text overlays and transitions
Looking for someone to convert C++ code from screenshots. I have used some OCR apps but the code generated has a bunch of typos, so you need to fix those, and provide a runnable code. ~2500 lines of code
I have a blank .NET MVC web application with single controller and single view, in the view there are the following fields: - Meta WhatsApp API keys - mobile number - message text box I have a send button on the view which posts the fields data to a method in the controller, I am looking for .NET MVC developer with meta WhatsApp API experience, who can integrate meta WhatsApp framework and write the required code in the controller method to send a WhatsApp message. Ideal Skills: - Proficiency in .NET MVC framework - meta WhatsApp API
I need an expert Android developer to upgrade my app's SDK and Gradle in Android Studio. Currently, I'm using the Ladybug version and need to ensure compatibility with SDK 34 and above. Key Requirements: - Update project to new SDK and Gradle versions. - Ensure compatibility with SDK 34 and beyond. - Troubleshoot and resolve any issues that arise during the upgrade process. Ideal Skills: - Extensive experience with Android Studio and Gradle. - Prior work with SDK 34 and above. - Strong problem-solving abilities and attention to detail.
I'm looking for an experienced videographer and editor with a strong background in creating serious and professional tone commercials. Key responsibilities include: - Dir...experienced videographer and editor with a strong background in creating serious and professional tone commercials. Key responsibilities include: - Directing and shooting a commercial aimed for social media with a serious and professional tone. - Incorporating cinematic techniques to elevate the production value. - Editing the footage to create a polished final product. Ideal candidates will have a portfolio showcasing similar work, particularly commercials intended for social media. Strong understanding of social media's visual and stylistic trends is a plus. Please include your previo...
I need a solution to read measurement values from a Bosch GLM50-27 CG device, which are currently in hexadecimal format, convert them to meters, and output them as numeric values for further calculations. Sample Data: - The data point C0-55-10-02-01-90-04-00-00-00-00-00-00-00-00-00-00-00-00-94 should convert to 515. Ideal Skills: - Proficiency in data conversion and analysis - Experience working with hexadecimal values - Familiarity with Bosch measuring devices would be a plus - Ability to create a program that outputs numeric values for further calculations Please note, the converted values will not be displayed on a user interface or stored in a database, but will be used in calculations directly.
...creative individual to compile 200 vegetable recipes for me. Each recipe will need to include a line describing its health advantages. The recipes will be organized according to the season, with each seasonal section on a separate page. Key elements of the project: - Design: The use of both high-quality, copyright-free photographs and minimalist-style illustrations is required. The illustrations should be clear and bright. - Health Focus: Each recipe must come with a line detailing its health benefits. - Seasonal Organization: The recipes need to be divided into sections according to the seasons. Ideal candidates for this project will have: - Experience in recipe writing/compilation. - A keen understanding of health and nutrition. - Skills in design ...
...designed to elevate my brand visibility. The primary focus of this project is to create an engaging, user-friendly platform that can help increase my brand awareness. Key Features: - High-quality visuals: The website should be visually appealing and aligned with my brand identity. Experience in graphic design and understanding of visual storytelling will be a plus. Ideal Skills: - Web Design: Proficiency in designing interactive and responsive websites. - Graphic Design: Ability to create high-quality visuals that can capture attention and effectively communicate my brand message. - SEO: Knowledge of SEO principles to ensure the website is discoverable. The goal is to create a site that not only represents my brand but also engages users and...
I need an expert to convert an image of a figure into a detailed 3D model suitable for 3D printing. The model should be high in detail, as it will be used for 3D printing. Ideal skills and experience for the job include: - Proficiency in 3D modeling software - Experience in creating models for 3D printing - Strong attention to detail to ensure a high-quality model - Ability to convert 2D images into 3D models
...editor to create high-quality, cinematic edits for my daughter’s YouTube channel, The Princess Aria Show. The channel focuses on fun, family-friendly content, and we want the videos to be engaging, visually appealing, and consistent with a professional style. Responsibilities: • Edit raw footage into polished, cinematic videos for YouTube. • Add creative effects, transitions, soundtracks, and on-screen text where needed. • Maintain a cohesive style and tone across all videos. • Collaborate on creative ideas to make the content exciting for a younger audience. Requirements: • Experience in video editing (YouTube-specific experience is a plus). • Proficiency in editing software like Adobe Premiere Pro, Final Cut Pro, or similar. &...
Convert to vector graphics and edit the logo name and color File is attached
I'm in need of a talented illustrator who can convert approximately 15 images into high-quality, moderately detailed, watercolor-style vector illustrations. These illustrations will be utilized across print materials, website graphics, and presentations. Key Requirements: - Convert/redraw/illustrate provided images into detailed, colorful illustrations - Deliver final outputs in AI, EPS, and SVG formats - Use of freelancer's creativity for color schemes, as specific palettes are not required Ideal Skills: - Proficiency in Adobe Illustrator and vector illustration - Experience creating illustrations for diverse mediums - Strong understanding of color theory and design principles - Ability to follow a moderate level of detail Please provide a portfolio of yo...
I'm seeking a creative game developer/graphic designer to design a custom movement path for player pieces in a Ludo game. The path should incorporate theme-based decorations, enhancing the visual appeal and immersiveness of the game. Key Responsibilities: - Create a unique, custom-designed path for player pieces, deviating from the traditional square grid. - Integrate visually appealing, theme-based decorations along the path. Ideal Skills: - Strong background in game design and development. - Proficient in graphic design, with a keen eye for detail. - Experience in creating interactive and visually engaging game components.
...content sections. Note the tone, style, and voice used. List areas to improve or differentiate. Analyze Design: Review color schemes, layouts, and font choices. Note user experience (UX) features. Study Navigation: Understand menu structure and page hierarchy. Check for logical flow and ease of use. Evaluate Graphics: Identify image and graphic types (photos, illustrations, icons). Observe placement and usage trends. 2. Content Development Rewrite Content: Create unique, engaging, and SEO-optimized copy. Use a tone consistent with your brand. Avoid duplicating any wording from the competitor's site. Add New Pages: Include additional value-added pages (FAQs, case studies, blog). Develop Keywords: Research keywords relevant to your niche. Optimize content for search eng...
I have a brochure designed in Canva that I need converted to a Coral Draw file. The original design is in PDF format. Requirements: - Convert the Canva-designed brochure from PDF to Corel Draw without any design alterations. - Deliver a Corel Draw file that meets standard compatibility. No specific version of Corel Draw is needed. Ideal Skills: - Proficiency in Corel Draw - Experience with Canva designs - Excellent attention to detail
I'm looking for a modern and sleek logo for my IT startup, Iybrid, which is primarily focused on IT Labour Hire Services including cloud SaaS services. The logo should reflect our tagline: "Empowering Connections, Deliver...Connections, Delivering Excellence, Transforming Futures". Additionally, a matching letterhead is also required. Key requirements: - The logo should be modern and sleek. - Color scheme: Blue and white. - Incorporate IT-related icons into the design. - Letterhead should be designed to match the logo. Ideal candidates should have: - Proven experience in logo and letterhead design. - Strong portfolio of modern and sleek designs. - Ability to incorporate abstract concepts into visual designs. - Understanding of IT and SaaS industry, ...
I am in need of a dedicated social media manager for my Facebook and Instagram accounts. The primary focus is on image-based content, with the ultimate goal being lead generation. Key Requirements: - Expertise in managing Facebook and Instagram - Proficiency in creating and curating engaging image content - Proven experience in strategizing for...content, with the ultimate goal being lead generation. Key Requirements: - Expertise in managing Facebook and Instagram - Proficiency in creating and curating engaging image content - Proven experience in strategizing for lead generation - Strong understanding of social media analytics and performance tracking If you can help me enhance my social media presence and convert it into a powerful tool for lead generation, I would love to...
...expertise in AI Character Creation to manage the social media accounts for a growing SaaS B2B brand. The role involves crafting a comprehensive content strategy, creating engaging posts, and leveraging an AI character to establish a distinctive and relatable brand presence. The ideal candidate will have a proven track record in content creation, engagement growth, and lead generation across platforms like Instagram, Facebook, LinkedIn, TikTok, and Twitter (X). Responsibilities: AI Character Creation & Integration: Design and develop a unique AI character that aligns with the brand’s goals and audience. Use the character as a focal point for engaging and creative social media content. Content Creation: Produce high-quality graphics, videos, and reels tailored ...
I'm in need of a skilled facade designer with a strong background in modern re...design. You will be responsible for creating a visually appealing and functional elevation for a modern-style home. The project will require you to use AutoCAD primarily, with a focus on minimalist lines and large windows typical of modern design. Ideal skills and experience include: - Proficiency in AutoCAD, with a preference for AutoCAD over other design software - Strong understanding of modern architectural principles - Previous experience in residential elevation design - Excellent visual and spatial awareness - Ability to incorporate sustainable design principles Please note that I do not have specific design elements or reference images to provide, so creativity and a...
Type: Web based Application to transcribe the conversation between the Call Center agent and then convert this to make meaningful information for the managers. Modus Operandi: 1. The user should be able to put the recorded calls into the system. To begin with only one recording can go in the system at one time 2. #TRANSCRIBE the Call Recording a. Identify the number of people in the conversation b. The system should be able to transcribe each of the point spoken by each of the person separately 3. #TRANSLATE the conversation in English language 4. #ENCRYPT the personal information in the information a. Name of the user to always be called "Cardholder" b. Name of the agent to always be called "Agent" c. C...
I'm looking for a skilled WordPress developer who can convert my Webflow page into WordPress. The tasks include: - Converting the site using any suitable theme that replicates the Webflow design - Adding a custom domain and linking it to my existing hosting - Modifying image galleries to ensure they are mobile-responsive. Keeping the current design with necessary adjustments. Ideal Skills: - Proficient in WordPress and Webflow - Experience with theme customization - Knowledgeable in responsive design - Familiar with domain linking and hosting Please provide examples of previous similar projects you have completed. Thank you.
I'm seeking a web designer to enhance the visual design of my website, giving it a modern and clean aesthetic. The focus for this overhaul will be on the following pages: - Home page - About Us page - Store page Ideal candidates will have a strong portfolio showcasing modern and clean web designs, as well as experience in redesigning similar pages. A keen eye for detail and a deep understanding of user interface and user experience principles will be highly beneficial for this project.
As part of this stage, I will process the first file and convert it into a MATLAB format. Additionally, I will apply some pre-processing to the data including filtering. The stage 2 will be to apply the same steps to all the available files and give you matlab files for each participant.
I'm in need of a skilled photo editor to enhance over 50 of my images. The project primarily involves basic retouching and the application of artistic filters to give the photos a unique touch. Ideal Skills: - Proficient in photo editing software (like Adobe Photoshop, Lightroom, etc.) - Experience in basic photo retouching - Creative mindset for applying artistic filters The selected freelancer should be able to demonstrate a keen eye for detail, a strong understanding of visual aesthetics, and the ability to deliver high-quality edits in a timely manner. Looking forward to seeing your bids!
I'm looking for an artistic and creative video editor to refine my personal video. The ideal freelancer will have experience with: - Applying artistic editing techniques to enhance the visual appeal of the video - Incorporating special effects seamlessly into the footage - Skillfully overlaying music to complement the video - Adding text and captions in a clear and engaging manner The goal is to create a polished, captivating video that tells a story and engages the viewer. Please provide samples of your previous work that align with this project.