Computer shoppy project vb net punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Elaborar interfaz de usuario enlazando componentes a base de datos, enlazar tablas a ComboBox, enlazar tablas al componente DataGridView, mostrar datos en TextBox.
I'm looking for a professional who can implement a state-of-the-art model for detecting and reading license plates from mixed lighting conditions. The primary application is traffic monitoring wit...the potential accuracy of the proposed models - Implement the chosen model - Calculate accuracy metrics post-implementation Ideal Candidates Should Have: - Previous experience in image processing and computer vision - Proficiency with state-of-the-art detection models - Background in developing systems for traffic monitoring preferred - Strong skills in OCR implementation - Ability to work with mixed lighting condition images Please provide examples of previous work in your proposal. Split the work into milestones, and provide the price for the first milestone. Also estimate tota...
This project involves building an MVC + .NET 9 application for video streaming with the following features: Video Listing and Playback: List all videos available on the file server. Allow users to play any video of their choice using either Direct Streaming or WebRTC (configurable). Real-Time Notifications: Use SignalR to notify users whenever a new video is uploaded. Automatically play the newly uploaded video immediately after receiving the notification, using the configured streaming method (Direct Streaming or WebRTC). Audio Recording: If a user wants to speak, they can click the "Speak Now" button to: Pause video streaming. Open the microphone and start recording audio. Once recording is stopped, the audio file is uploaded and stored on the file server. Pla...
I need help with a very simple C# Windows Forms application. I am completely stuck whenever I try to make this and need someone to help me complete this. The application requires the following features: - A user ...if the user inputs 40 for speed and 3 for hours, the output should show 40 miles for hour 1, 80 miles for hour 2, and 120 miles for hour 3. The application also requires basic input validation to ensure the text boxes are not empty and contain numerical values. If the input is invalid, a message box should be displayed. Ideal skills and experience for the job include: - Proficiency in C# and .NET Framework - Experience with Windows Forms applications - Ability to create simple, user-friendly interfaces - Understanding of basic input validation and error handling in app...
I need a skilled graphic designer to edit a 2D image of a spaceship. Attached is a png image of the spaceship. I want you to modify it and create new images, based on it: 1) One image of the spaceship with the cockpit open. The gold nuggets are visible. 2) One image of the spaceship, with the cockpit open. The cargo is empty. We can...with the cockpit open. The gold nuggets are visible. 2) One image of the spaceship, with the cockpit open. The cargo is empty. We can see the metal panels of inside the cargo. 3) The cargo is full of gold nuggets. A set of 6 images of the cockpit progressively closing. I need clean work with attention to detail. Especially the colors and the lighting. The resulting image will be included in a computer game. I want full IP ownership of the resulti...
Get this sample code running and debugging in a Docker container using in VS Code and .NET 8, on my Mac. Will need a Docker files created which start up the .NET container and the RabbitMQ container. I may need a screenshare to help me get it up and running. I'm new to VS Code.
.Net application needs a new grid in one of the modules. See the attached file. Development is to be done on the local machine.
...Here's a description of a professional, impactful logo design: Logo Elements Typography: Use modern, sans-serif fonts to convey innovation and professionalism. Highlight "CallCatch" in bold or slightly larger font, with "AI" in a futuristic, tech-inspired style to emphasize the AI aspect. Icon: A sleek phone symbol or a missed call notification icon to represent calls. Incorporate an abstract "net" or "catching" element, such as a swoosh or loop, to symbolize capturing leads. Include subtle AI-related imagery, like a circuit board pattern, a small brain icon, or digital waves, integrated into the phone or catching element. Color Palette: Blue and green tones to evoke trust, technology, and growth. Accent colors like orange or yello...
...compatible with the Figma design and implemented using .NET framework 8, SQL server DB, JavaScript, and AJAX (in search). - Two language versions are required: Arabic and English. - All website functionalities need to remain unchanged, including user authentication, data reporting, real-time updates, and all existing links and data. Some links should be editable from the control panel to open external links ; So you need to use same control panel (I Well provide old source code). - Integration of social media into the new version. - You are responsible for publish website on our server (on Google cloud) - We need guides to SEO Ideal Skills: - Strong UI/UX design capabilities. - Extensive web development experience, particularly with .NET framework 8, JavaScript, and AJAX....
...opportunities. We provide test administration and accommodation solutions to test-takers worldwide. For this purpose, we look for professionals who we contact on an "as-needed" basis to see if they are available to assist test takers for their approved accommodations. We provide complete training and assignments pay hourly for the entire scheduled time, even if the exam ends early. We have a computer exam coming up where a test taker has been approved for Reader and Recorder. This where you read exam content aloud to the test taker and then enter the answers as they direct. The exam is taking place at a professional testing center in Manama, Bahrain. The individual should be comfortable in English and Arabic. The exams will take place on 17 January, 2025 from 9:30 a...
I'm seeking a skilled React Developer to spearhead our Front End development efforts. You will be responsible f...React within the Microsoft stack - Optimize RESTful APIs for our data-driven applications - Ensure high code quality through regular governance and reviews - Collaborate with various teams and customers in an Agile setting Requirements: - Over 4 years of hands-on experience with React, JavaScript, HTML5, and CSS - Proven expertise in REST API development and Agile methodologies - Familiar with the .NET stack and modern Front End tools such as Babel and Webpack Desirable: - Knowledge of Azure - Experience in regulated industries If you're an experienced React Developer looking to take the next step in your career with a dynamic, growth-oriented company, I enc...
Good afternoon, We are looking for offers to transform hand-drawn plans into computer-generated plans. We offer $5 for each floor of a property. If you do another projects such as renders please let us know the prices for future references
Good afternoon, We are looking for offers to transform hand-drawn plans into computer-generated plans. We offer $5 for each floor of a property
Ich benötige einen Entwickler für .NET MAUI, welcher eine Medikations App erstellen kann für das Kommissionieren von Medikamenten. Der Kommissionierprozess sieht ähnlich aus wie bei einem Logistiker. Weitere Details folgen in einem Meeting. Ausschliesslich deutsch sprechende Entwickler!
I am looking for a house designer who can work full time for us. Requirement - Strong with ArchiCAD, SketchUp and Lumion - Have string laptop/computer, it must be able to render Lumion - Have experience in doing both exterior and interior.
...à ses besoins (objectifs sur Instagram, budget, etc.). - Mener à bien à la phase de négociation pour finaliser la vente du coaching Instagram. La rémunération : - 10% du montant total de la vente générée par chaque client apporté. - Les commissions seront versées une fois que le client aura payé la formation et que le contrat sera signé. - Les commissions sont calculées sur le montant net après application de toute réduction ou remise éventuelle. Durée & contexte de la mission : - Mission à durée indéterminée, avec des objectifs mensuels de prospection et de mise en relation à atteindre. - Tél&ea...
I need a proficient Django developer to integrate the Razorpay Payment Gateway into my Django Oscar-based eCommerce platform. Requirements: - Implement support for multiple currencies in the payment gateway. - Integrate various payment methods including Credit/Debit Cards, Net Banking, and UPI. Having a signed up Razorpay account, I am looking for someone who can transform my platform to support global transactions seamlessly. Future-proofing is important, hence the ability to accommodate 'Maybe in the future' scenarios for multiple currencies is key. Ideal Skills and Experience: - Deep understanding and hands-on experience with Django and Django Oscar. - Proven track record of integrating payment gateways, specifically Razorpay. - Strong knowledge of multi-currency sup...
I need a professional to create a survey dashboard in Power BI for analyzing customer feedback. The primary metric of focus is the Net Promoter Score (NPS), which will be sourced from online surveys. Ideal Skills: - Proficient in Power BI - Experience with customer feedback analysis - Understanding of Net Promoter Score Please provide examples of similar projects you have completed.
I am looking for a Hindi-speaking individual to visit our warehouse in Port Klang, Malaysia. The purpose of this visit is to teach a small group of our Indian staff (1-5 members) basic computer skills. Skills to be taught include: - Using a web browser - Using Google Sheets - Using Microsoft Excel The level of proficiency we aim for is basic. Your role will be crucial in helping our staff become more computer literate and improving their productivity. Ideal candidates will have: - Proficiency in Hindi and Malay - Strong knowledge of basic computer skills - Experience in teaching or training - Patience and good communication skills
I'm seeking a graphic designer with a knack for bold and eye-catching visuals to cr...final product should be chic and appealing. Ideal Skills: - Graphic design, particularly for apparel. - Experience with bold, graphic design. - Understanding of color theory and stylish combinations. - Ability to integrate text into a design seamlessly. NO AI generated image please as I need to have Ai file for design! Added some ideas (just for reference) also like the trucker cap with design on net as added (not the right look and feel). Hat needs to have the word on: FOUTE Can add at back if it fits: Wat maak ons die naweek? The hat will have a bottle opener in (see attached image), no need to add it to design only for reference as he also has a drink that is named after this song. Art...
...functional, responsive web applications. • Optimize applications for maximum speed and scalability. • Write clean, maintainable, and efficient code. • Participate in code reviews and provide constructive feedback to team members. • Troubleshoot and debug applications to ensure optimal performance. • Stay up-to-date with emerging technologies and industry trends. Requirements: • Bachelor’s degree in Computer Science, Engineering, or a related field. • 3+ years of professional experience in full stack development. • Proficiency in Vue.js and Node.js. • Strong experience with Azure Cloud and AWS services. • Development experience in AWS serverless cloud environments, including Lambda, EventBridge, AppSync, DynamoDB. • Expe...
...crowdfunding project focused on precious metals, specifically through my website www.blacklions.net. This project is aimed at raising capital for production within a 90-day mission timeframe. To attract potential investors, I am in need of compelling website content, specifically success stories and testimonials. This content should demonstrate the potential of our project and instill confidence in our mission. Ideal candidates for this project should have: - Experience in writing engaging and persuasive content - A background in finance or investment, particularly in precious metals - Ability to meet tight deadlines - Strong understanding of crowdfunding dynamics >>> TEN (10 Kgs) SIMULATION MISSION – 61,400 USD Amount Sponsorsh...
I'm looking for a skilled graphic designer to help me create some designs using Illustrator, which I can install on my computer. If you have experience with Illustrator and can work with a variety of design needs, please reach out.
Responsibilities: • Front-End Development(Webflow): • Translate designs for web pages, landing pages, and other web con...as Figma. • Basic understanding of version control systems (e.g., Git). • Additional Skills: • Strong problem-solving and analytical skills. • Excellent attention to detail and commitment to quality. • Ability to work independently and collaboratively in a fast-paced environment. • Passion for staying on top of the latest web technologies and trends. Bonus Points: • Formal education in design, computer science, or a related field or equivalent experience. • Experience designing for the web. • Experience working with animation libraries (e.g., GSAP/Framer/motion) to enhance interactivity. • Knowledge of ...
I need an iPad app developed from my existing React Native Expo project. The Web version of the React Native project is here: You must have truly hand-on experience with React Native and iOS development. You guide me how to do it step by step, and solve any issues during the process, till an app is installed on my iPad. You have to work remotely on my computer via AnyDesk. Souce code is very valuable and cannot be sent.
...achieving milestones! •What You’ll Do: Promote Our Website: Share the website with your network via social media, chats, emails, or word of mouth. Generate Leads: Encourage them to sign up and make a profile on our website through your unique referral link. •Requirements & Extra Benefits: No Special Skills Required: We provide all the resources and training to get you started. A smartphone or computer with internet access. Great for New Freelancers :Gain experience and build your freelancing portfolio. Bonuses for Results: Earn additional rewards for hitting lead generation goals! Flexible Work: Work from anywhere, anytime, at your own pace. Self-Leads Eligible: You can even sign up or purchase to contribute to your earnings. •What You’ll Earn: C...
...communication and much computer knowledge, I help businesses and individuals bring their ideas to life while meeting their goals effectively. What I Offer: ["Custom video editing and uiux designing tailored to your brand identity."] ["High-quality content writing that captivates your audience."] [ "Responsive and user-friendly websites to enhance your online presence."] Why Choose Me? Attention to Detail: I ensure every project is polished and meets the highest standards. Timely Delivery: Deadlines are a priority; your time is valuable to me. Clear Communication: I'm here to collaborate, listen, and deliver exactly what you need. Client Satisfaction: Your success is my success. I go the extra mile to exceed expectations. Let&r...
I'm in need of a Computer Science paper tailored for ACM journals, specifically focused on the area of Artificial Intelligence. Key Aspects: - The paper should concentrate on theoretical research within the realm of AI. - A significant portion of the paper should be dedicated to formal proofs. - The writing style and formatting should be appropriate for ACM journals. Ideal Candidate: - Profound understanding of Artificial Intelligence and theoretical research. - Excellent skills in developing and explaining formal proofs. - Experience with ACM journal publication process and standards. - Strong academic writing skills.
im conected to a clasifeds url but in my android i recive information faster..meanwhile in my andoid appears"posted 10 minutes ago" in my computer appears "posted 5 minutes ago" im using the same wifi conection.. refreshh diferent browsers etc. this is not issue about hardware maybe both device are conected to the same website bur virtually are conected in diferent place
I need someone to design country-specific pages on the Local Net Live website. Each page will be for a different African country, in accordance with their population size, as outlined in the Decentralized Nexus of African Countries project. The designs should be similar to the Nigeria page. Key Requirements: - Each page should feature a recruitment form for local operators. - The recruitment form needs to collect the following information: - Name and contact details - Previous experience - Reason for applying - The recruitment form should also allow for file uploads, specifically for: - Resume/CV - Portfolio Ideal Skills: - Web Design - Understanding of Decentralized Systems - Experience with building forms and file upload functionality on websites.
...SRAS-LRAS-AD Model Analysis Effects of: Decreased money supply by the central bank. Decreased tax rate by the government. Increased future expected interest rates. Labor market liberalization and its impact on natural unemployment. Open Economy and IS-LM Model** Role of exogenous interest rates. Deriving IS* and LM* curves. Equilibrium exchange rate, income, and net exports. Impacts of changes in NX on exchange rate, income, and net exports under flexible and fixed exchange rate regimes. Phillips Curve Analysis Scenarios involving expected vs. actual inflation rates. Impacts of government spending increases and inflation reduction policies on the economy in the short and long run. Fiscal and Monetary Policy Delays Arguments against using fiscal and monetary policy due to d...
I'm seeking a talented graphic designer specialized in logo creation to craft a unique logo for a computer science oriented initiative. A deep understanding of the tech field and its nuances would be immensely helpful in this process. Ideal skills for the job include: - Proficiency in graphic design software - Prior experience with tech Logo design - Strong understanding of computer science concepts - Ability to translate complex ideas into visual representations A comprehensive portfolio showcasing previous logo designs, particularly those related to the tech industry, will significantly boost your chances of being selected for this project. Please feel free to reach out if you have any questions or need further clarification.
As an illustrator in the Grand Rapids, Michi...illustrator in the Grand Rapids, Michigan area, I'm seeking your talent to hand sketch ideas into life for a 6 hour brainstorming session with our client. The sketches will primarily be used for product design concepts, and I'm looking for someone who can create rough sketches to bring these ideas to life. Looking for someone who can hand sketch ideas quickly on a flip chart… not illustrate things on a computer. This has to be someone who is fast and flowing. Ideal skills and experience for the job include: - Proficiency in hand sketching - Experience in product design illustration - Ability to create rough, yet insightful sketches - Creative thinking to visualize concepts - Strong communication skills to understand a...
I need a web application built in ASP.NET or .NET, with Microsoft SQL storage, aimed at fostering spiritual growth among youth and young adults. This platform will primarily facilitate group discussions and training events. Key Features: - Group Discussions: Users need to be able to join different groups for discussions, based on their interest. - Multimedia Sharing: The platform should allow for the sharing of text-based posts and photos. - Azure Hosting: The code will be hosted in Azure. Future Phases: - Following the completion of the web application, a mobile application will be developed in Phase 2. Please Review: For project requirements and user stories please the attached documents Your Bid Should Address: - Your suggested database architecture/design for th...
I'm looking for a C# developer to create a basic color mixing program using Windows Forms and the .NET framework. This simple application should utilize the standard primary colors, with 6 radio buttons (red, blue, yellow) for color selection. Key Features: - Upon selecting a color from each of the three sets and clicking 'Mix', the background changes to reflect the newly mixed color. - An option to reset the colors to their default state. - An exit button to close the application. The color mixing process should be visualized as an instant change upon clicking 'Mix'. Ideal Skills: - Proficiency in C# and .NET Framework. - Experience with Windows Forms applications. - Ability to create simple, user-friendly interfaces. -If you need an idea of what...
I'm looking for an SEO expert who can help boost my website's visibility, and increase traffic. The website is ...website is designed to generate leads and sales through service descriptions and products that can sourced for clients. Key Requirements: - Proven experience in SEO, particularly for service-based websites. - Ability to create strategies aimed at increasing website traffic. - Understanding of lead generation and e-commerce. -Milestone will be release after work is done after the first 30 days (Net 30) Please note, I skipped the question regarding my current lead generation channels. However, I am open to recommendations on how to enhance my lead generation and sales through other channels such as social media, email marketing and paid advertising. Freelanc...
...domain renewal dates - Add and remove domains in bulk - Move domains between different portfolios - Name portfolios (e.g., Generics, traffic, jamesdomains, etc.) - Import domain name revenue for cost comparison - Add domain name costs per extension (e.g., .com, .net, .xyz, etc.) to monitor yearly costs of each portfolio - Export files per portfolio, as well as a global export - Backup daily and send via email The script should use a simple Username & Password authentication method. The ideal freelancer for this project should have prior experience in domain management and web script development. Knowledge of domain valuation and renewal processes is a plus. The script should allow for import/export in CSV and Excel formats. I'm open to additional...
I’m looking for a skilled .NET developer with extensive experience in the ABP Framework. The project is to develop an application that is user-friendly and sleek in its interface. The application will consist of Products, Sales, Payments, Dashboards, and reporting, and will include Web, API, and MAUI projects. Key Features: - Focus on a modern and sleek user interface - Prioritising user experience - Both desktop and mobile optimisation Ideal Skills: - Proficient in .NET and ABP Framework - Experienced in creating modern user interfaces - Skilled in both desktop and mobile application development - Knowledgeable in developing applications with eCommerce features (Products, Sales, Payments) - Capable of creating detailed dashboards and reporting systems Please ...
...to ensure smooth debt recovery processes. - Manage communication with third-party agencies to resolve cases efficiently. Personal Profile: - Articulate with excellent communication skills and a clear, professional approach. - Able to commit to 4 hours per day, 3 days a week, with no other demanding role on the side. - Initiative-driven with a sharp, intelligent approach to problem-solving. - Computer confident, with proficiency in the relevant software and tools. - Solid credit control experience with a proven track record of success. Must-Haves: - Proven experience in debt recovery or a similar role. - Strong telephone communication and negotiation skills. - Ability to handle challenging conversations and persistently follow up. - Familiarity with legal debt recovery process...
The concept of my software is as follows: I provide an input in this format: f.proxys5.net:6200:70255400-zone-custom-sessid-OV8O1koo-sessTime-15:184fERnR From this line, the IP address () is automatically extracted and checked against the following websites: : To determine the proxy type. If the proxy type is identified as Residential or Cellular, the process continues. : To check the fraud score of the IP address. If the fraud score is below 10, the original proxy line is included in the output. The software delivers only the valid proxy lines that meet these criteria as the final output.
I'm seeking an SEO professional to boost sales on three UK-based eBay accounts for my computer company. Key Focus: - Primarily, I want to enhance the product titles to improve visibility and attract more potential buyers. - Your expertise in identifying and targeting specific keywords will be crucial to our success. Ideal Skills: - Proven track record in eBay SEO - Excellent understanding of keyword targeting - Experience with product title optimization - Background in computer/electronics sales is a plus Your mission will be to help increase our sales through effective eBay SEO strategies. If you have the necessary skills and experience, I look forward to your bid.
I'm seeking an experienced DevOps professional to set up a GPU server ...DevOps professional to set up a GPU server on Google Cloud. The server will primarily be used for running machine learning models, specifically in the field of Computer Vision. The preferred framework for these models is TensorFlow. Key Responsibilities: - Set up and configure the GPU server on Google Cloud. - Ensure the server is optimally tuned for TensorFlow and Computer Vision tasks. - Provide documentation and support for server usage. Ideal Skills: - Extensive experience with Google Cloud and vast.ai. - Strong background in DevOps, particularly in setting up GPU servers. - Proficiency in TensorFlow and Computer Vision. Please include examples of similar projects you've complet...
I'm in need of a skilled computer-aided designer with a strong background in machine design. The project involves designing structural elements primarily intended for load-bearing support. Key Requirements: - Design of structural elements using CAD software - Expertise in creating load-bearing support components - Experience working with composite materials in design The ideal candidate will have a strong engineering background, excellent CAD skills, and a deep understanding of composite materials. Your design should ensure maximum strength and durability while also considering weight and efficiency. PS: NEED DESIGNER FROM FROM DELHI & NCR, INDIA ONLY
I need an experienced ASP.... This file and the accompanying vb code can be found in the attachment. There are eight files that the user may download and it is hard-coded that these files are called: • • • • • • • • I would like to retain the first two, delete the other six and add two new ones: • • Changes in the files available to download would impact a couple of other pages as well: and ManageSubscriptions.aspx. These files and their accompanying vb code are also in the attachment.
We are a call center looking for spanish speaker agents. You need to have computer (no smartphone, no tablet), speed internet , usb headset, dedicated space where to work. Computer knowledge and fast learning attitude are must. Salary 3$/hour If you have read bid for 10$ CV for evaluation part time or full time option Working hours between 9am to 10 pm local time
