College management system documentation vb net punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
...spoken everyday. Availability: ASAP Main responsibilities: The ideal candidate is expected to carry out the following duties both in Russian language: Sales: first point of contact for advices and general enquiries from prospects: what products to buy, prices, offers, quotations, advises on design, colours, sizes, expected delivery times, guarantees, sales policies, etc… Order management: checking clients’ artwork, verifying colours, making graphic files quick fixes and modifications using Photoshop, coordination for the manufacturing and approval of samples Post sales support: helping customers solving problems with deliveries, tracking parcels online (EestiPost, Omniva, DPD, TNT, FedEx, UPS, etc…) handling issues reported by clients with p...
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui
nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui
I'm seeking a seasoned developer to assist in implementing Dapr Workflows within my Dotnet application. The primary focus will be to efficiently manage complex workflows related to inventory management and time-keeping microservices. Key Requirements: - Profound understanding of Dapr and its capabilities. - Expert level Dotnet development skills. - Hands-on experience with microservices, particularly in inventory management and time-keeping. - Proven ability to navigate and manage complex workflows using Dapr. Specific responsibilities will include: - Integrating with various third-party APIs and managing database connections. - Designing and overseeing database integrations. Ideal Candidate Skills: - Proficient in working with message queues, specifically RabbitMQ. -...
...aligns with the unique preferences, tone, and voice of each client. The vision is to create a system where users can select a client from a list. Upon selection, the tool will adapt its content generation approach based on client-specific parameters, stored in a database. Additionally, the tool should learn and adapt its writing style over time by analyzing previously submitted content, improving its ability to match each client’s unique voice. Since this is my first venture into AI-based content generation, I would greatly appreciate the guidance of an experienced developer on how best to build this tool and structure the project. Scope of Work: Client-Specific Model Customization: Develop a system that allows users to select a client (e.g., Client A, Client B, e...
I need an expert CS Cart developer for a three-stage project: 1. Establish a test domain on our server. 2. Upgrade to the latest version of the Viva...a test domain on our server. 2. Upgrade to the latest version of the Viva Shop theme. 3. Comprehensive check of all customizations in CS Cart via the "My Changes" add-on. This includes not just the modifications made by the freelancer, but all prior customizations by different freelancers. Skills and experience required: - Proficiency in CS Cart - Experience with the Viva Shop theme - Server management skills - Ability to conduct a thorough inspection of previous customizations - Problem-solving skills to address any issues that may arise We have discussed all points in our other chat, but if you still have doubts please ...
I need a professional to integrate an Employee Scheduling and Time Tracking system on the employee side of my website. This system should enable me to monitor the hours worked by my staff accurately. Key Requirements: - Comprehensive employee scheduling functionalities encompassing shift scheduling, availability management, and time-off requests. - Complete time tracking features including clock-in/clock-out functionality, timesheet approvals, and overtime calculations. - A multi-faceted clock-in/out system with a web-based interface, mobile app, and biometric system options. Skills and Experience: - Proven experience in website development and integration of scheduling and tracking software. - Knowledge in creating user-friendly web interfaces for emp...
I'm looking for an expert social media stra... - Creating and curating engaging content and ad campaigns for Instagram, with potential expansion to Facebook, TikTok, Twitter, and YouTube. - Regularly interacting with our audience to foster community and brand loyalty. You'll be joining a small team of three, where your role will be distinct and significant. The ideal candidate would be someone with a proven track record in social media management and content creation, particularly on Instagram. Experience targeting specific demographics and driving engagement is crucial. Given the nature of our target audience, skills in understanding and creating UGC (User Generated Content) will be highly beneficial. I have an ongoing need for this role, with payment up to a TBD budge...
I'm seeking a professional to install and configure KiwiIRC on my Linux ubuntu server. The requirements are straightforward: - I need the software set up with default settings, but with the inclusion of custom channels. - The installation should not include any additional modules or plugins - just the basic KiwiIRC setup. Ideal ...professional to install and configure KiwiIRC on my Linux ubuntu server. The requirements are straightforward: - I need the software set up with default settings, but with the inclusion of custom channels. - The installation should not include any additional modules or plugins - just the basic KiwiIRC setup. Ideal candidates should have: - Proven experience with KiwiIRC - Strong Linux server management skills - Ability to set up custom channels...
I'm seeking a dedicated individual to oversee 20 YouTube Short Channels, 5 Instagram channels, and 1 Twitter Channel. Your primary responsibility will be to manage these accounts and post pre-made videos that I will supply on a daily basis. Ideal Skills and Experience: - Prior experience in managing social media channels - Familiarity with YouTube Shorts, Instagram, and Twitter - Ability to follow instructions and adhere to a daily posting schedule - Basic understanding of video content and social media trends
I'm in need of a full-stack developer proficient in Frontend Bootstrap and Laravel. The project entails designing a responsive, interactive front-end with custom themes and implementing a back-end with essential Laravel functionalities. Key Responsibilities: - Front-End: Design and implement a Boot...Laravel to manage user data. Ideal Candidate: The perfect freelancer for this project would be someone with extensive experience in full-stack development, particularly with Bootstrap and Laravel. A strong understanding of responsive design, interactive components, and custom theming in Bootstrap is crucial. Additionally, experience with user authentication and authorization, as well as database management and migrations in Laravel, will be key to successfully executing this proj...
I'm looking for a professional to help me refine an existing tax questionnaire focused on Individual Tax Forms, and convert it into an autofill PDF. The project involves: - Reviewing and editing the questionnaire for grammatical errors - Realigning radio buttons and other elements for consistency and clarity - ...refine an existing tax questionnaire focused on Individual Tax Forms, and convert it into an autofill PDF. The project involves: - Reviewing and editing the questionnaire for grammatical errors - Realigning radio buttons and other elements for consistency and clarity - Enhancing the overall quality and professionalism of the document Ideal candidates should have experience with tax-related documentation, have strong attention to detail, and be proficient in PDF ed...
...dedicated Virtual Assistant to assist with data entry and operational tracking. The ideal candidate should be detail-oriented, organized, and proficient in handling spreadsheets and data management systems. Your responsibilities will include: Customer Meal Plan Tracking: Maintain accurate records of customer meal plans, including start dates, end dates, and meal preferences (Lunch/Dinner, Veg/Non-Veg, etc.). Update records in real-time for changes such as plan renewals, cancellations, or modifications. Cross-check data to ensure consistency with the company's internal system and delivery records. Daily Expense Management: Log daily operational expenses (e.g., food supplies, packaging materials, delivery charges). Categorize expenses by type (e.g., raw mater...
I'm looking for a Python script that leverages RoBERTa to automate the identification...synonym replacement, sentiment label mapping, and implementing data augmentation and class balancing. - Analysis and Evaluation: The script should perform correlation analysis and generate a heat map. The model's effectiveness should be evaluated using metrics like accuracy, F1 score, precision, recall and determining optimal thresholds. Also, the model should prioritize: - Technical skills - Management experience - Educational background Ideal Skills: - Proficiency in Python and RoBERTa - Experience with data preprocessing and analysis - Ability to implement and evaluate machine learning models - Familiarity with generating and interpreting heat maps - Understanding of recruitment pr...
...team seeks a dedicated specialist to design and implement secure biometric storage solutions that meet both operational and regulatory requirements. Job Summary: We are looking for a skilled Biometric Data Storage and Integration Specialist to manage the capture, storage, and reuse of client thumbprint data for the Eauto platform. This role involves creating a compliant, secure, and efficient system to store biometric data for a longer period while ensuring it aligns with third-party (JPJ) requirements for temporary registration. Key Responsibilities: • Develop and implement secure storage solutions for biometric thumbprint data. • Integrate biometric storage systems with the Eauto platform for efficient and secure data reuse. • Extend the storage duration of ...
I'm seeking an expert in thermal analysis and materials science to help with a comprehensive project. 1. Thermal Gradient Analysis: - ...minimize the thermal gradients. - This includes investigating novel materials with better thermal conductivity that can still be compatible with existing Li-ion technologies. 3. Thermal Management Strategies: - The development of tailored thermal management systems for cold climates will be a key part of this project. - You should also consider hybrid solutions, including phase change materials (PCMs) and localized heating elements. Ideal skills for this job include thermal analysis, materials science, and experience with Li-ion technologies. A background in developing thermal management systems and advanced TI...
Hello Unreal developers! We are a team full of experienced developers who are working for a new old school Football game at Unreal engine. We need someone to join us and help at gameplay part for single and multiplayer modes online and offline! Key Responsibilities: - Assist in the implementation of special moves and skills - Contribute to team management and strategy mechanics - Help with the integration of physics-based ball control You will be working with existing assets and code. Your ideal qualifications include: - Extensive experience with Unreal Engine - Strong understanding of gameplay mechanics - Prior experience in developing sports games is a plus - Proficiency in multiplayer functionality and AI development Join us in creating an exciting and engaging football exper...
... Key Responsibilities: Campaign Strategy & Setup: Design campaigns based on the provided angle and target audience. Conduct audience research and set up ad targeting to ensure maximum reach and engagement. Creative Development: Write persuasive and engaging ad copy aligned with the campaign angle. Design custom ad images or videos that capture attention and drive clicks. Campaign Launch & Management: Configure ad campaigns, including budget allocation and bidding strategies. Monitor campaign performance and adjust settings as needed to optimize results. Reporting & Analysis: Provide regular updates on campaign performance metrics, including CTR, conversion rates, ROI, and audience engagement. Offer actionable insights to improve future campaigns. Requirements: P...
...and build instructions for ease of use. Verify the Wasm build by running a basic CGAL test (like a simple Boolean mesh operation). Expose common CGAL functions to JavaScript for direct usage in web projects. Deliverables: Dockerfile and supporting scripts. Clear documentation on how to build and run the container. Instructions on using the compiled CGAL WebAssembly module in a basic web project. Ideal Skills: Strong experience with Docker and containerization. Familiarity with CMake, C++ libraries, and dependency management. Experience with Emscripten and WebAssembly compilation. Familiarity with CGAL and Boost libraries is a plus. If you have experience with WebAssembly and C++ builds, we'd love to hear from you! Please include examples of similar work co...
Hola buenas noches. Me dedico a realizar trabajos de carpinteria de diseño y a medida enfocado en lo que es amoblamientos de melamina. Estoy buscando un software que me permita poder llevar a cabo registros, control y seguimiento en acciones puntuales sobre mi actividad. Basicamente lo que busco es que contenga 3 modulos. Uno de Ventas, Otro de Producción y uno de contabilidad. La idea es poder llevar a cabo un registro desde que un posible cliente se contacta conmigo por un trabajo, desde ahí dar seguimiento hasta que la venta se concrete y concluya la instalación o entrega del mueble o por el contrario que la venta no se concrete. Basicamente sería como un CRM con el agregado de producción en donde pueda llevar la trazabilidad en tiempo real so...
...Deductions/Adjustments: Treaty-based deductions (IRS country treaty benefits). Partial rent deduction (as the internship was remote). California-specific deductions (including rent-related deductions). Scope of Work: Review my previous filing and ensure all calculations and deductions are accurate. Prepare and assist with filing taxes for the entire year (federal and California state). Advise on proper documentation to submit for both W2 and self-employment income. Ensure compliance with treaty benefits and local tax laws. Expected Time Commitment: This is a straightforward task, estimated to take no more than 1 hour. Qualifications: Licensed CPA in California. Familiarity with tax laws for international students and non-resident income treaties. Experience with W2 and self-...
Estoy buscando un programador que hable español y que tenga experiencia en .NET para crear una API Rest. Esta API debe leer archivos en formato XML, validar el contenido y el esquema de estos archivos, y finalmente insertar los datos en una tabla de SQL Server. - La validación de los datos es crucial antes de ser insertados en la base de datos. - Proporcionaré especificaciones detalladas sobre cómo debe llevarse a cabo la validación. Idealmente, el candidato debe tener: - Sólida experiencia en programación en .NET. - Conocimientos sobre la creación de APIs Rest. - Habilidades para trabajar con SQL Server. - Capacidad para validar datos de acuerdo a un esquema y contenido. - Dominio del español tanto hablado co...
I'm looking for an expert who can set up a fully automated system for my daily, informational and engagement posts across Facebook, Instagram, and TikTok. The ideal candidate will have expert knowledge of Canva, creating custom templates from scratch, tailored to my posting needs. Key Responsibilities: - Create from-scratch Canva templates for different types of posts. - Set up a workflow using Google Sheets and Zapier to auto-populate those templates. Skills and Experience Required: - Expert knowledge of Canva. - Proven experience in social media management. - Proficiency in using Google Sheets and Zapier for automation. Your role will empower me with a seamless system to share daily posts, engaging my audience effortlessly.
SEO, Google/META Ads & Content Management Services USA
...full-flag, web-based application for complete project cycle management in the oil and gas sector. Key Requirements: - The application should support the full project lifecycle, from initiation to closure. - Project tracking features should include Gantt charts for visual planning, task assignments for team coordination, and progress dashboards for real-time updates. - Resource management capabilities should focus on inventory management, ensuring efficient tracking and utilization of supplies. Ideal Skills: - Extensive experience in project management software development, particularly for the oil and gas industry. - Proficiency in creating interactive Gantt charts and progress dashboards. - Strong understanding of inventory management systems. A de...
I'm looking for a WordPress expert to set up a travel booking website for me. The site should have: - A booking system - A sign-up feature for local travel clients - A contact form - A newsletter subscription feature Additionally, I need the site to be integrated with MailerLite for newsletter management and customer engagement. I already have a logo and a theme ready, but if you have a more suitable one, feel free to use it. The site will consist of 5 pages and 25 blog posts. Please note, the budget for this project is $25 and the deadline is in 3 days. You can use my setup or theme, or if you have a more suitable one, feel free to use it. Ideal candidates should have: - Extensive experience with WordPress - Knowledge of MailerLite - Skills in web development and e...
...a user management dashboard, completing some unfinished features, and deploying the project. The application is built using Golang, C++, and Flutter, and supports web, iOS, and Android platforms. Key Responsibilities: - Diagnose and fix bugs across the web interface, mobile app, and backend system - Develop a user management dashboard - Complete unfinished features - Deploy the project on time The bug fixes are a priority and need to be resolved in the short-term. I have a clear vision for the specific enhancements I want and am ready to discuss these in detail with the right developer team. Ideal Skills and Experience: - Proven track record in bug fixing and feature development - Expert in Golang, C++, and Flutter - Experienced in project deployment - Excelle...
I'm looking for a freelance video and photo editor who can create and implement a plan for my personal vlogs. The job will involve editing videos, photos, and crafting engaging posts. Key Responsibilities: - Edit 5-10 photos and 5 videos (range from 5 to 20 minutes each) monthly - Schedule posts on YouTube, TikTok, and Instagram - Write casual and friendly copy for all posts Ideal Candidate: - Experienced in video editing with minimal editing - Skilled in crafting engaging social media posts - Able to understand and replicate a casual and friendly tone - Prior experience with vlog-related content is a plus
I'm seeking an Excel expert to develop a contract management dashboard and trackers specifically tailored for oil and gas and EPC projects. Key Functions of the Dashboard: - Tracking contract deadlines - Monitoring project budgets - Generating reports Data Input: - The dashboard will need to connect to a database for data input. Data Visualization: - The data needs to be visualized using pivot tables. Ideal Skills: - Proficiency in Excel with a focus on creating complex dashboards. - Experience in the oil and gas sector or EPC projects would be highly advantageous. - Knowledge of database connections and pivot table visualizations.
...critical role in managing and optimizing our workflows, social media presence, and lead generation strategies. Key Responsibilities: Workflows and Automations: • Create and manage workflows and automations using platforms like or GoHighLevel (GHL). • Draft compelling email and text content for campaigns. • Ensure workflows align with our brand’s voice and objectives. Social Media Management: • Create and schedule content, including graphics, images, and/or videos for all social media platforms (e.g., TikTok, Facebook, Instagram, LinkedIn). • Maintain consistent posting schedules and engagement strategies. • Use tools like social media schedulers to organize posts effectively. Must have an eye for good videos that may go viral I’l...
...help me design a professional and corporate styled website. Key Features: - Custom WordPress Design: I want a modern, sleek, and professional looking site that reflects the corporate nature of my business. - Client Portal: This portal should include functionalities such as appointment booking, invoice management, and service requests. - Employee Portal: Although I have not fully decided on the functionalities for this portal, it will likely include aspects of job scheduling and timesheet management. Ideally, the freelancer for this project should have extensive experience with WordPress and WordPress theme customization. A portfolio of similar corporate projects would be a plus. Good communication skills and a collaborative spirit are essential, as I want to work closely...
Scope of Work: Full Website Redevelopment for We are seeking an experienced web developer to fully redevelop our website with the following specifications: Core Requirements: Listings Features: Sales Properties: Display Sales Price, Net Operating Income (NOI), and CAP Rate (calculated as NOI ÷ Sales Price). Lease Properties: Include NNN, NN, or N status, monthly lease payment, and lease term (in years). Option to hide sensitive details if requested by the seller/landlord, displaying "Inquire" instead. Excluded Pages: Omit Business listings, the News, Books for Sale, and Directory pages from the new website. Keyword Matching Algorithms: Develop algorithms for matching users with properties based on specific keywords like location, property type, and investment...
I'm seeking an expert in Discord server setup to help me create a pristine, professional server aimed at selling digital products. The server should be visually appealing and easy to navigate, with a layout that supports sales, customer service, and...promote our offerings - Spaces for References and Feedback, fostering trust and transparency - Community Chat Channels for engaging with our customers - Regular Notices to keep our members informed The ideal freelancer for this project should have extensive experience with Discord, particularly in setting up servers for sales. Skills in bot development, customer service integration, and community management will be highly regarded. A knack for creating captivating digital layouts and experiences will greatly enhance the quality ...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
...new social media channel focused on providing informative and educational content, specifically tutorials and how-tos on the PIANO, across TikTok, Instagram, and Pinterest. Task: Create social media strategy for TikTok, IG, and Pinterest separately. Output should be 3 different strategies (please be detailed) about each one. Ideal skills and experience: - Proven experience in social media management, particularly on TikTok, Instagram, and Pinterest. - Exceptional content creation skills, with a focus on informative and educational content. - Strong understanding of social media trends and algorithms. - Excellent communication and community engagement skills. ** This is a new page, so there are hardly any followers. I am looking for someone I can grow with over time (i.e. to w...
I'm in need of a SharePoint page dedicated to vehicle management with a strong focus on tracking vehicle maintenance. Key Features: - Service history logs: Keeping a comprehensive record of each vehicle's service history. - Automated maintenance reminders: This is a crucial feature and should be prioritized. The system should notify us of upcoming maintenance needs. - Parts inventory management: A system for monitoring the parts inventory and when replacements are necessary. - Assigning vehicles to users: The ability to designate specific vehicles to specific users. - Storing key vehicle and user information and files: A database for important information related to the vehicles and users. - Warranty information: Keeping track of each vehicle's ...
I'm seeking a professional PHP developer to create a food management system with the following features: - **Functionality**: The system should have robust inventory tracking and order processing capabilities. It's crucial for the system to efficiently manage resources and handle customer orders seamlessly. - **User Roles**: The system should support an admin user role. The admin should be able to oversee all operations within the system. - **User Authentication**: A comprehensive user authentication system is needed. This should facilitate login through social media platforms, ensuring ease of access and security. Ideal candidates for this project should be proficient in PHP and have experience in developing management s...
...Identity Management Permissions and Access Control: Managing NTFS permissions, file sharing, and role-based access. Best Practices: Securing servers with firewalls, antivirus/anti-malware solutions, and patch management. Certificate Services: Using public key infrastructure (PKI) and SSL/TLS certificates. 4. Scripting and Automation PowerShell: Automating tasks such as user management, system configuration, or service deployments using PowerShell. Batch Scripting / Other Tools: Although less common now, some organizations still use older Windows scripts or third-party tools. 5. Monitoring, Maintenance, and Troubleshooting Event Logs: Reading and interpreting Windows Event Viewer logs for diagnostics. Performance Monitoring: Using built-in tools or third-party...
...new social media channel focused on providing informative and educational content, specifically tutorials and how-tos on the PIANO, across TikTok, Instagram, and Pinterest. Task: Create social media strategy for Tik Tok, IG and Pinterest separately. Output should be 3 different strategies (please be detailed) about each one. Ideal skills and experience: - Proven experience in social media management, particularly on TikTok, Instagram, and Pinterest. - Exceptional content creation skills, with a focus on informative and educational content. - Strong understanding of social media trends and algorithms. - Excellent communication and community engagement skills. ** This is a new page, so there are hardly any followers. I am looking for someone I can grow with over time (i.e. to ...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I need someone to help me publish my autobiography on my Facebook page. The content is already prepared, I just need it formatted and published. Ideal skills for this job include: - Proficiency in social media management, specifically Facebook - Experience in content formatting for social media - Attention to detail to ensure the content is accurately represented - Ability to work independently and follow given instructions
...Spring Boot and AWS is a must for this role. Integration with External Platforms: I need help connecting the system with Shopify, TikTok, and various parcel carriers. This will require solid experience in API integration and possibly some front-end work. Specific Requirements for the Integration with Shopify: Order Management: You'll be responsible for ensuring that our system can effectively manage and process orders from Shopify. Inventory Management: I need you to create a seamless integration between our warehouse system and Shopify's inventory system. This will involve real-time tracking of stock levels, and prompt updates. Carrier API Connection: You'll be required to connect our system to various parcel carriers. T...
We are looking for a dynamic and tech-confident Financial Controller to join our team on a full-time contract basis (9am to 5pm Brisbane Time Australia). You will oversee the financial operations for a group of companies, including property development businesses, while leading a remote bookkeeping team and driving the use of technology to streamline financial management and reporting. You must be engaged, confident and passionate about delivering great work. Key Responsibilities: - Lead and manage bookkeeping tasks by outsourcing to a remote team, ensuring accurate and efficient financial operations. - Prepare and report on business budgets, forecasts, and actuals, with a focus on operational and property development finances. - Confidently manage payruns for both business o...
I'm in need of a s...developer to implement backend logic and database and dashboard management for a society management mobile application, acquired from Codecanyon. The app is built in React Native, but requires completion of backend functionality and database integration. Key Requirements: - Implement user authentication and API endpoints in the backend. - Use MySQL as the database management system. - Develop a new API for the application. Ideal Skills: - Experience with React Native applications. - Proficiency in backend development and database management. - Expertise in developing with MySQL. - Capable of creating a new API from scratch. For refer:
I'm seeking a seasoned project manager to oversee web design and digital marketing initiatives for my clients. This is an ongoing, long-term opportunity. Key Responsibilities: - Manage web design projects with a strong focus on functionality. - Oversee digital marketing efforts, particularly on social media platforms and SEO. Ideal Skills and Experience: - Proven experience in project management within the web design and digital marketing sectors. - Excellent understanding and prioritization of web design functionality. - Deep knowledge and experience in managing social media and SEO projects. - Strong leadership and communication skills.
...admin panel. I need a skilled developer to customize, host, and deploy the app on my Hostinger VPS server (Linux) using aaPanel as the control panel and successfully upload it to both Google Play Store and Apple App Store. Key Requirements: 1. App Customization: Modify the app to comply with Google Play Store and Apple App Store policies: Replace real-money transactions with a points/rewards system if necessary. Fine-tune existing features, including multiplayer functionality, tournaments, and bots. Add/modify UI/UX elements to make the app visually appealing and user-friendly. 2. Hosting Setup on Hostinger VPS: Install and configure aaPanel on my Linux VPS (Hostinger). Deploy the Node.js multiplayer server and connect it with the MySQL database. Set up the PHP admin panel on t...