Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 view page crystal report vb net u gjetën punë

    Pershendetje, puna eshte shume e thjeshte. Duhet te beni Like 30 postimet e fundit ne faqen tone te Instagram dhe Facebook nga 20 profile REALE Ju lutem na shkruani per cdo pyetje dhe nese bashkepunimi eshte i kenaqshem do kemi pune te tjera per ju.

    €32 Average bid
    €32 Oferta mesatare
    19 ofertat
    €15 Oferta mesatare
    12 ofertat
    €11 Oferta mesatare
    10 ofertat
    Programing
    Ka përfunduar left

    Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

    €11563 Average bid
    €11563 Oferta mesatare
    4 ofertat
    Crie um Website
    Ka përfunduar left

    Desenvolvedor .NET MVC, SQL e ADVPL Protheus

    €2808 Average bid
    €2808 Oferta mesatare
    1 ofertat
    qefqreqweqawdafsc
    Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €189 Average bid
    €189 Oferta mesatare
    1 ofertat

    Stranica za uredivanje slika i stranica

    €367 Average bid
    €367 Oferta mesatare
    5 ofertat
    yveguwvcjnjnecbkhb
    Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €108 Average bid
    €108 Oferta mesatare
    1 ofertat
    AI-Powered Assistant/Agent
    6 ditë left
    Të verifikuara

    ...reports. c) Other standard business correspondence. • The assistant should be able to understand my verbal/text input for email requirements and draft professional responses accordingly. 5. Daily Dashboard Automation • Consolidate data from Smartsheet into a daily dashboard emailed to me and my team leads. • Include progress updates, order status, team performance, and KPIs. • Schedule the report to send automatically every morning. 6. Outlook Email Organization and Suggested Replies • Integrate with Microsoft Outlook to: a) Categorize and prioritize emails automatically. b) Suggest responses using context from previous emails, attachments, and Smartsheet data. c) Allow me to review and approve AI-drafted replies. 7. Meeting Summaries and Insights...

    €1524 Average bid
    €1524 Oferta mesatare
    9 ofertat

    I'm looking for a video creator who can use my world map image to build a 5-minute video similar to the one found at Key Elements: - The video should include threat visualization elements. This means showing various threats on the map as if they were occurring in real time. Scope: - The video should provide a global view. We will provide the artwork of the world map. Style: - The tone of the video should be simple and straightforward. It should not be overly complicated or difficult to follow. Ideal skills for this job include: - Proficiency in video editing and animation software - Prior experience with creating similar interactive map videos - Ability to visualize and represent data clearly and simply. IN SUMMARY. This video is to be 5 mins long,

    €100 Average bid
    €100 Oferta mesatare
    15 ofertat
    New Tradeshow Booth Mockup Design -- 2
    6 ditë left
    Të verifikuara

    ...proportional. - Text on banners should be large enough to read clearly from a slight distance. - **Brand Consistency:** - Orange is the primary brand color (as in “Aur Kab Tak?”). - Keep contact details near the bottom if you include them: `` and ``. ### **5. Deliverables & Format** - **High-Resolution Mockups**: - At least 1–2 perspective angles (e.g., front-facing and a slightly angled side view) to show the entire booth environment. - **File Format**: - JPEG or PNG for quick reference. - (Optional) Source file from 3D software or layered PSD if possible. ### **6. Additional Notes/Instructions** - The look should closely mimic a real event photo—avoid overly “cartoonish” or obviously computer-generated styles. - If refere...

    €48 Average bid
    €48 Oferta mesatare
    11 ofertat

    I'm looking for a talented pixel artist who specializes in 1 bit style art to create game assets for me. Specifically, I need: - 1 bit Indoor scenes - Intricate and engaging animations, characters, and objects/items within those s...artist who specializes in 1 bit style art to create game assets for me. Specifically, I need: - 1 bit Indoor scenes - Intricate and engaging animations, characters, and objects/items within those scenes - Whole project will approximately consist of 7-8 different scenes and 5-8 seconds for each scene. (seconds per scene may change but total of all animations will be around 1 minute) You can kindly view the screenshot in attachment which belongs to the trailer of "World Of Horror". If you watch that trailer, you will get the style and th...

    €896 Average bid
    €896 Oferta mesatare
    11 ofertat

    ...PROVINCE 77000 THAILAND • Has a camera or phone/tablet of quality with a camera, internet access • Must be available during business hours (9 AM - 4 PM) on working days Please see the attached file for the site visit guidelines. You are only required to deliver the pictures, video & observations and are not expected to assemble a report like the Sample Report. Note: Milestone will be released the following week after the site visit to give us time to organize the report and contact you if we need additional clarification....

    €57 Average bid
    Lokale
    €57 Oferta mesatare
    1 ofertat

    ...company's management and operational practices is also required. Legal Documents for Review: - Corporate Governance Documents: A thorough review of the company's corporate governance documents is necessary. - Litigation and Dispute Records: I need an analysis of the company's litigation and dispute records. Reporting: - I require a detailed analysis with recommendations: The final due diligence report should include a comprehensive assessment of the findings with actionable recommendations. Ideal Skills and Experience: - Extensive legal background, particularly in corporate law and regulatory compliance - Proven experience conducting due diligence on publicly traded companies - Excellent analytical skills - Ability to provide practical recommendations based on f...

    €408 Average bid
    €408 Oferta mesatare
    9 ofertat
    Spintax Development for Lpagery Mass Page
    6 ditë left
    Të verifikuara

    I'm utilizing the Lpagery mass page builder on my WordPress site, and I require a Spintax system for my anchor texts, which will be exact match keywords. Key tasks: - Implement a Spintax that varies anchor texts across different pages - Generate synonyms for my keywords using the Spintax The ideal freelancer for this project should have: - Experience with Lpagery mass page builder - Proficient in Spintax creation - Strong understanding of SEO and keyword usage - Ability to generate relevant synonyms

    €160 Average bid
    €160 Oferta mesatare
    41 ofertat

    Hi Dipti, It has been a while since I have hired you. Hope you are doing well. Could you fix the "services" page on my website? Right now, all of the services are not showing up, and there are duplicates. It is working correctly when a category is selected, but not when the filters are cleared. Working example:

    €14 / hr Average bid
    €14 / hr Oferta mesatare
    1 ofertat

    I am currently facing some errors in my Angular frontend that's part of a .NET Web API project. Key Responsibilities: - Troubleshoot and debug existing Angular components - Identify and fix issues with data binding, component creation and form validation Ideal Skills: - Proficient in Angular with experience in developing and debugging complex frontend applications - Familiarity with .NET Web API - Experience with NgRx for state management Please note, the goal is to get my frontend running smoothly and effectively communicating with the backend.

    €19 Average bid
    €19 Oferta mesatare
    11 ofertat

    ...descriptions. Ensure all sections of the GMB profile are complete and professional. Requirements: Experience with Google My Business setup and optimization. Strong research skills, particularly using Google Maps. Knowledge of local SEO best practices. Ability to deliver daily research reports and handle GMB setup tasks promptly. Excellent communication skills and attention to detail. Deliverables: Daily Report with 20–30 researched businesses, including key details and GMB optimization gaps. Fully optimized Google Business Profiles for clients, completed within agreed timelines. Budget: Monthly Budget: $300 (approximately $10/day for research and profile setup). Rate structure: Open to hourly or project-based payments within this budget....

    €239 - €717
    I cilësuar Urgjent I vulosur
    €239 - €717
    14 ofertat

    ...transformation strategy Technology stack optimization Performance optimization and scalability solutions Industry Solutions Enterprise Resource Planning (ERP) systems Customer Relationship Management (CRM) solutions Business Intelligence and Analytics platforms Workflow automation systems Our Technical Expertise Frontend: React.js, Angular, Vue.js, HTML5/CSS3 Backend: Java, Python, Node.js, .NET Mobile: iOS (Swift), Android (Kotlin), React Native Database: SQL, NoSQL, MongoDB, PostgreSQL Cloud: AWS, Azure, Google Cloud DevOps: Docker, Kubernetes, Jenkins Our Development Approach Agile methodology with iterative development Regular client communication and progress updates Comprehensive testing and quality assurance Post-deployment support and maintenance Documentation and k...

    €17 / hr Average bid
    €17 / hr Oferta mesatare
    15 ofertat

    Job Description: We need an experienced iOS developer to create a private app for internal use. The app will integrate with our ERP system’s API to allow employees to view and update job statuses efficiently. Scope of Work: • Develop a lightweight, user-friendly iOS app using Swift or SwiftUI. • Securely integrate the app with our ERP’s REST API. • Create department-specific interfaces for retrieving and updating job stats. • Assist with app testing and deployment using Ad Hoc or Apple Business Manager distribution. Requirements: • Proven iOS development experience. • Strong knowledge of API integration and secure authentication. • Ability to deliver clean code and clear documentation. This app will streamline workflows and improve ...

    €17 / hr Average bid
    €17 / hr Oferta mesatare
    16 ofertat

    ... --Respond to opportunities within the 12 AM - 2 PM PST timeframe, --Receive training on completing project forms and stay updated on new topics in IT consulting. --Schedule consulting jobs by reviewing Calendly availability, updating the project website with availability, and sending Outlook invites for confirmation. --Track and document responses to IT consulting project forms. --Monitor and report metrics related to the number of completed project forms, scheduled jobs, and other relevant data. --Update Consulting Profile with appropriate keywords. **Perform other assigned tasks as needed** Requirements: IT Consulting Virtual Assistant --General knowledge of IT applications, infrastructure, and security vendors or have experience with IT companies --Proficient in reading and...

    €11 / hr Average bid
    €11 / hr Oferta mesatare
    33 ofertat

    **Project Title:** React Website for a New Cryptocurrency Token on Solana **Project Overview:** We are launching a new cryptocurrency token based on the Solana blockchain and need a professional, responsive React and Firebase based website. The website will have three main components: a public landing page, an admin dashboard, and a user dashboard. Below are the detailed requirements for each component. --- ### **1. Landing Page** The public-facing landing page will serve as the main introduction to the token and will include: - **Introduction & Token Information:** A visually appealing and creative section to introduce the token, its features, and benefits. - **Price Chart:** A dynamic chart displaying the token's price trends for various timef...

    €469 Average bid
    €469 Oferta mesatare
    25 ofertat

    ...Users should be able to easily locate legal services based on various filters. - User Reviews and Ratings: A section for user-generated content is critical. This will aid in building a community and providing feedback for businesses. - Attorneys Profile Pages: Each attorney should have a dedicated page containing pivotal information. - Map: Integration of a mapping system to guide users to physical locations. - Offline Access: Some business profiles should be accessible offline, enabling users to view information without needing internet connectivity. - We need two sign in/log in interfaces, one for users and one for the attorneys. - High Security - multi language feature - Both Android and iOS - Need quote app only, and quoted for website + app - Confidential and copyrigh...

    €575 Average bid
    €575 Oferta mesatare
    33 ofertat

    I'm seeking a qualified pathologist or professional to assess autopsy photos concerning an important person. The aim is to prepare a statement for a press release and for research purposes. Your assessment will specifically focus on: - Injury evaluation The report will be intended for a general public audience, so clear, accessible language is crucial. Ideal skills and experience for the job: - Medical qualifications with a focus on pathology - Experience writing for a non-specialist audience - Ability to assess and interpret injury-related findings - Strong understanding of press release format and requirements

    €86 Average bid
    €86 Oferta mesatare
    17 ofertat

    Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.

    I cilësuar Urgjent I vulosur MRS

    ...specifications: - The house will include a basement and an upper portion, with a construction space of over 500 square meters. - The design should minimize heat trapping, using suitable glass types for summer. - The architecture should be inspired by Moroccan riad designs and should include a dome roof structure with air catchers for better cooling. - The house will have multiple living rooms for a 360-degree view, as well as a beautiful garden with waterways. Essential rooms: - Living room and kitchen - Bedrooms and bathrooms - Home office and study room - Guest room - Additional servant quarter - Prayer room Desired features: - Shaded verandas and courtyards - Dome roof structure with air catchers - Waterways around the garden The ideal candidate will have experience in mode...

    €130 Average bid
    €130 Oferta mesatare
    29 ofertat

    I'm looking for a talented web developer who can bring my design to life with Nuxt or VueJS (typescript) and GSAP ...design to life with Nuxt or VueJS (typescript) and GSAP for an animated, visually captivating service showcase landing page. Key Responsibilities: - Implement the design of the landing page - Create an animated hero section that captures attention - Develop clear, engaging service overview sections Ideal Skills and Experience: - Proficient in GSAP and web development - Experience with implementing designs into functional web pages - Understands how to create engaging, user-friendly interfaces - Able to work from a provided design - Proficient with Nuxt/Vue with Typescript Please reach out if you have the necessary skills and experience to create this ...

    €145 Average bid
    €145 Oferta mesatare
    9 ofertat

    ...Develop custom ranking algorithms (similar to PageRank or keyword relevance). 3. Admin Panel: • Purpose: Build an Admin Panel to allow easy management of the crawler and indexed data. • Features: • Crawler Settings: Control crawl frequency, depth, and site list. • Index Management: View, edit, and delete indexed data. • Crawl Logs: Display logs of all crawling activity, errors, and successful crawls. • Re-indexing Options: Manually trigger re-indexing when data changes or needs to be refreshed. • System Monitoring: View real-time stats about the crawling process and indexed data performance. 4. Search Engine Development: • Purpose: Develop the frontend and backend of the search engine for users to search results from the indexed dat...

    €428 Average bid
    €428 Oferta mesatare
    11 ofertat
    C# Power BI Optimization PluginV2
    6 ditë left
    Të verifikuara

    I'm looking for a C# plugin for Power BI Desktop that can help me optimize my reports. The plugin should: - Detect unused columns in tables and create M queries to remove them. - Scan all open Power BI reports and list them in a combo box for selection. - Identify all measures in the selected report and provide optimized DAX code for each. A list of these measures should also be in a combo box. My primary data sources are SQL DB and Excel, so experience with these is crucial. The plugin needs to work with both imported data and DirectQuery modes.

    €29 Average bid
    €29 Oferta mesatare
    1 ofertat

    I'm seeking a top-tier web designer to create a professional, engaging, and modern minimalist one-page website for my comic art gallery. The site will need to support both English and Japanese, with a language toggle at the top. (I will supply the art for mobile & desktop) The site will include the following sections: - Intro - Gallery (this is the most crucial section) - About Me - Upcoming Events - Contact Page Given the target audience of this site - highly talented artists in the comic industry - and the anticipated high traffic, the website needs to be of A++ quality. I'm looking to incorporate best practices in art and web design. You'll need to provide: - Expert-level design capabilities - Strong web development skills - Understanding of SEO prin...

    €13 / hr Average bid
    €13 / hr Oferta mesatare
    61 ofertat

    ...Development Specialist to help us acquire freelancing projects in web development. Your role will include finding and bidding on projects, communicating with clients, and closing deals on platforms like Upwork, Freelancer, Fiverr, and Bark. Responsibilities: Identify and bid on relevant projects. Communicate with clients to understand their needs. Create winning proposals and close deals. Report progress regularly. Skills Needed: Experience with freelancing platforms (Upwork, Fiverr, etc.). Strong communication and negotiation skills. Familiarity with web development services (especially WordPress). Compensation: This is a commission-based role: 10%-20% of the project value, depending on the size of the deal. Performance bonuses for hitting targets. If you’r...

    €19 Average bid
    €19 Oferta mesatare
    2 ofertat

    ...your favorite food? Rana: My favorid food is Indonesian food. 9. Asking and Giving Opinion Asking and giving opinion adalah ungkapan yang dipakai untuk meminta pendapat atau memberi pendapat. Contoh ungkapan untuk meminta pendapat di antaranya, yaitu: What do you think about…? What do you think of…? Do you have any opinion on…? What is your point of view? Sedangkan contoh ungkapan memberi pendapat di antaranya yaitu: ●I think…. ●In my view.. ●In my opinion… ●I feel…. ●It seems … ●I don’t think ….. Agar lebih paham, simak percakapan berikut ini: Sara: What do you think about this skirt? Sofi: I think it’s too short for you. Sara: Do you think so? What about this one? Sofi: Yeah, I think that’s bett...

    €932 Average bid
    €932 Oferta mesatare
    23 ofertat

    The purpose is to hire a qualified freelance professional to develop comprehensive training materials, including theoretical content, practical labs, and exercises, for a 15-day training program focused on: - RSLogix 5000 v32 - FactoryTalk View v13 **Scope of Work** The selected freelancer will be responsible for: 1. Developing 15 days’ worth of detailed training content for RSLogix 5000 v32 and FactoryTalk View v13. 2. Creating practical lab exercises and troubleshooting scenarios. 3. Ensuring the materials are designed for a blended learning approach (theory + hands-on). 4. Providing step-by-step instructions for configuration, programming, and troubleshooting. 5. Aligning the content with industry best practices and real-world applications. 6. De...

    €47 Average bid
    €47 Oferta mesatare
    13 ofertat

    I'm in search of a talented web developer to create a comprehensive, multi-page website for my import-export consulting business. Main Sections: - About Us: This should detail our mission, vision, and team. - Services: A breakdown of the various consulting services we offer in the import-export domain. - Contact Us: This will include a simple form for inquiries, alongside our business contact details. Ideal Skills and Experience: - Proficient in web development languages (HTML, CSS, JavaScript, etc.) - Experienced in creating multi-page websites. - Able to design user-friendly and informative web layouts. - Familiar with import-export business terminologies and trends is a plus.

    €44 Average bid
    €44 Oferta mesatare
    14 ofertat

    ...to enhance my e-commerce site's visibility on in light of the new November 2024 EAT update. Key Responsibilities: - Implement on-page, off-page, and technical SEO strategies to improve search engine rankings. - Focus on content quality, backlinks, and page speed as primary ranking factors. - Regularly monitor and report on progress, adjusting strategies as necessary to ensure continual improvement. Ideal Skills: - Expertise in all areas of SEO. - Proven experience with e-commerce sites. - Up-to-date knowledge of Google’s ranking factors and algorithm changes. - Excellent understanding of content quality, backlinking strategies, and page speed optimization. Please note that my primary objective for this project is to improve search engin...

    €83 Average bid
    €83 Oferta mesatare
    21 ofertat
    Trophy icon Top Navigation Bar Refresh
    2 ditë left

    I'm looking for a designer to enhance the top navigation bar of our website. Look at the picture. JUST THE TOP NAV BAR ONLY. The current design isn't visually appealing enough and the readability could be improved. Key Tasks: - Refresh our existing Market Movers Report logo. This should be a slight update, using the same colours as the original logo. - Enhance the top navigation bar. This should incorporate a more appealing visual design and improved readability, while still aligning with the overall design of our homepage. Requirements: - Use the same colours and fonts as the rest of our homepage. - Design with a 'sleek and modern' aesthetic in mind. The refreshed logo should be purely text-based without any icons or symbols. Skills and experience ideal fo...

    €119 Average bid
    I garantuar
    €119
    29 kandidaturat

    I need an expert to help set up my Asana for managing consulting projects. Key aspects of the setup will include: - Creating projects and tasks specifically tailored to consulting - Designing project templates for efficiency - Setting up tasks for client onboarding and management - Scheduling and appointment setting - Report generation and reviews The ideal candidate should have significant experience with Asana, particularly in setting up projects and tasks. Experience in the consulting field would be an advantage. Excellent organizational skills and attention to detail are essential.

    €7 / hr Average bid
    €7 / hr Oferta mesatare
    9 ofertat

    I'm seeking a talented writer experienced in crafting Wikipedia articles to create a biographical piece about a public figure. Key Requirements: - Proven experience in writing for Wikipedia - Exceptional research and writing skills - Ability to adhere to Wikipedia's standards and guidelines - Capable of creating a compelling and neutral biograp...Wikipedia's standards and guidelines - Capable of creating a compelling and neutral biography I can provide a wealth of resources including: - News articles - The official website of the subject - Interviews Your task will be to sift through these materials, extract the most relevant information, and present it in a manner that's suitable for Wikipedia. Please ensure to maintain a neutral point of view and adhere to W...

    €859 Average bid
    €859 Oferta mesatare
    39 ofertat

    ...service. - Lead Analysis: Ensure leads align with my service and have high conversion potential. - Sales Strategy: Develop a strategy to convert these leads into paying clients. - Lead Nurturing: Engage leads to build trust and encourage conversions. - Sales Closing: Close at least 2 confirmed sales from these leads. Budget: $10 (fixed price). Timeline: 1 month. Deliverables: - Niche Research Report: 20 leads with verified contact details, company name, job title, and a brief problem overview. - Sales Confirmation: 2 confirmed sales through these leads, verified via Fiverr order details. More details: - Is this project for business or personal use? Starting gig on Fiverr - What information should successful freelancers include in their application? Detailed project pro...

    €29 Average bid
    €29 Oferta mesatare
    3 ofertat
    Nationalism Analysis: In-Depth Report
    6 ditë left
    Të verifikuara

    Project Objective: Write a short report (500–800 words) analyzing a chosen political movement (Nationalism, Globalism, Religious Traditionalism, or Progressive Activism). Project Structure 1. Title Choose one movement to focus on and create a title for your report. Example: “The Role of Nationalism in Contemporary Politics” or “Globalism: Connecting Nations to Address Climate Change.” 2. Introduction (100–150 words) • Define your chosen political movement. • Briefly explain why this movement is important in the modern world. • Cite your chosen case study or example. Example: Nationalism is a political movement that emphasizes the importance of national sovereignty and cultural identity. In recent years, movements such as Brex...

    €26 Average bid
    €26 Oferta mesatare
    39 ofertat

    I'm in need of a seasoned social media marketer with a special focus on TikTok. The primary aim is to enhance our brand visibility on this platform. Key Responsibilities: - Strategize and implement engaging TikTok content aimed at increasing our brand awareness. - Monitor, analyze and report on campaign performance. Ideal Candidate: - Proven experience in social media marketing, particularly on TikTok. - Creative mindset with ability to generate engaging content. - Proficient in data analysis and performance tracking.

    €11 / hr Average bid
    €11 / hr Oferta mesatare
    16 ofertat

    ...candidate should have expertise in creating, editing, and debugging Google Apps Scripts to streamline data handling, calculations, and report generation. Requirements: Proven experience with Google Apps Script for Excel/Google Sheets automation. Ability to create custom scripts to automate repetitive tasks, manage data, and enhance productivity. Knowledge of integrating third-party APIs (if needed) with Google Sheets. Strong problem-solving and debugging skills. Effective communication and ability to meet deadlines. Scope of Work: Analyze the current Excel workflow and identify automation opportunities. Develop scripts to automate data entry, formatting, and report generation. Ensure error handling and smooth functionality of the automation. Provide documentati...

    €86 Average bid
    €86 Oferta mesatare
    6 ofertat

    I am currently facing some errors in my Angular frontend that's part of a .NET Web API project. Key Responsibilities: - Troubleshoot and debug existing Angular components - Identify and fix issues with data binding, component creation and form validation Ideal Skills: - Proficient in Angular with experience in developing and debugging complex frontend applications - Familiarity with .NET Web API - Experience with NgRx for state management Please note, the goal is to get my frontend running smoothly and effectively communicating with the backend.

    €19 Average bid
    €19 Oferta mesatare
    1 ofertat

    I am currently facing some errors in my Angular frontend that's part of a .NET Web API project. Key Responsibilities: - Troubleshoot and debug existing Angular components - Identify and fix issues with data binding, component creation and form validation Ideal Skills: - Proficient in Angular with experience in developing and debugging complex frontend applications - Familiarity with .NET Web API - Experience with NgRx for state management Please note, the goal is to get my frontend running smoothly and effectively communicating with the backend.

    €19 / hr Average bid
    €19 / hr Oferta mesatare
    13 ofertat

    ...design. - Create a design that aligns with a modern and sleek aesthetic. - Deliver a high-quality, web-optimized logo. The ideal candidate should have: - A strong portfolio of modern logo designs. - Excellent understanding of color theory and digital design. - Ability to take specific color instructions and create a cohesive logo. New Logo: Spanish ABBI = Asociacion de Blockchain & Bancos Internacional English IBBA = International Blockchain & Banking Association ABBI where the I ends add BBA goin down and close in a Block style logo As we are going international I would like to merge above letters into logo: Spanish- Asociación de Blockchain & Bancos Internacional

    €96 Average bid
    I garantuar
    €96
    238 kandidaturat

    I am currently facing some errors in my Angular frontend that's part of a .NET Web API project. Key Responsibilities: - Troubleshoot and debug existing Angular components - Identify and fix issues with data binding, component creation and form validation Ideal Skills: - Proficient in Angular with experience in developing and debugging complex frontend applications - Familiarity with .NET Web API - Experience with NgRx for state management Please note, the goal is to get my frontend running smoothly and effectively communicating with the backend.

    €21 / hr Average bid
    €21 / hr Oferta mesatare
    32 ofertat

    I'm looking for an expert in process automation to streamline report generation and approval workflows in my company. The goal is to have these processes automated on a daily basis using data sourced from Google Sheets. Ideal Skills and Experience: - Proficiency in Google Forms and Google Sheets - Strong experience in process automation - Ability to set up daily automated workflows - Knowledge of report generation automation - Familiarity with approval workflows automation Automation of below Live Feeds from My team in forms to sheets: -Lead generation -Contact details -Dispatch advises -Conversion advise -Reservation -Lpo request -Expense report -Visit report -physical inward -Physical outward -LR tracking  -TC request

    €37 Average bid
    €37 Oferta mesatare
    8 ofertat

    I'm looking for a comprehensive web-based platform that can analyze and rank YouTube videos based on various metrics. I want the platform to focus on: - Analyzing and ranking videos based on metrics - Utilizing key metrics such as view count, engagement rate (likes, comments, shares), and watch time for the ranking process - Allowing me to select specific channels or videos that will be included in the ranking This project requires an experienced web developer with skills in data analytics and familiarity with YouTube's API. The ideal candidate will have a proven track record of creating similar platforms.

    €233 Average bid
    €233 Oferta mesatare
    19 ofertat

    I'm looking for a data entry specialist to collect email addresses from a specific website. The site has 480 pages, and there ar...a data entry specialist to collect email addresses from a specific website. The site has 480 pages, and there are 10 companies per page. What You Need to Do: - Navigate through the 480 pages and 10 companies per page. - Collect email addresses and input them into an Excel file. - Format: One email per cell. Ideal Skills and Experience: - Proficient in Excel. - Good attention to detail. - Previous experience in data collection or web scraping is a bonus. Please note, I only require the email addresses, not any additional information.

    €13 Average bid
    €13 Oferta mesatare
    39 ofertat