Vb net read text file into datatable punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
PLEASE CONTACT ME TO DISCUSS FURTHER
PLEASE CONTACT ME TO DISCUSS FURTHER
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
...red,violet,number, total amount green total amount red total amount violet total amount which number and control panel Auto result option low amount colour & low amount number and withdraw manage options all information update control panel *GAME PANNEL* ID NAME MOBILE NO 4. AVAILABLE BALANCE NICK NAME BORD & READ RULE ,LEVEL 1&LEVEL 2,APPLY SACTIONS RECHARGE IN SIDE RECHARGE RECORD SAME WITHDEAWAL RECORD TO BALANCE MY PROMOTIONS CODE,MY PROMOTION LINK,COPY LINK ,RECHARGE,WITHDRAWAL,TRANSACTIONS CARD IN SIDE NAME IFSC CODE BANK NAME BANK ACCOUNT NO MOBILE NO EMAIL ID UPI ID CONTINUE TO ADD ADDRESS SECURITY IN SIDE RESET PASSWORD
READ CAREFULLY, ITS NOT LIKE OTHER PROJECTS. I'm looking for a collaborator to create a 2D fantasy RPG about witches with me using GameMaker Studio. This project will involve working along side me as I learn how to create games. I am a novice but I learn quick and I feel the best way to learn is to just get in there. There will be things where I am happy for you to go ahead and create (to save us both some stress), but I will require a walkthrough of the code afterwards so I can at least understand why things are doing what they're doing. Ideally we will meet on a casual basis that works for both of our availability. Im thinking 1-2 hour sessions, once or twice a week. As for assets, etc. The project will include both purchased asset packs (such as
I'm seeking a detail-oriented freelancer for data entry. The job entails retrieving text data from various web sources and inputting it into a database. Ideal Skills: - Proficient in data entry - Excellent attention to detail - Familiarity with database management - Experience in sourcing data from the web - Strong understanding of text data
...30-40 pages, organized into relevant sections as per the "Business Continuity Management Policy ". - You need to analyze the document as we send as model ("Business Continuity Management Policy ") and read and analyze the Adamo description of services ("Adamo "), and apply the structure of the model document to the functionality and the services that provides Adamo. - Emphasize sections on Risk Assessment, Incident Response Plan, Business Impact Analysis, Business Continuity Plan and Information Security Policy. - Utilize flowcharts as visual aids to enhance understanding of the technical aspects. - The end document should be in both English and Spanish, with the Spanish translation done via an online tool. - Please split the information ...
I'm looking for someone to read a script and being videotaped for 4 hours. The purpose of this video is educational for the general public. I prefer a male between 35-60 in Los Angeles, or Ventura county. The project is helping people to learn the I Ching. Everyting is scripted and not writing or improvising needed. In the process you learn how to prctice the I ching that will help you for the rest of your life.
...customization for one page on my WordPress website. The website is built using the Elementor Pro theme and template. The website address is: (temporary domain, so it looks unusual). Code: 5762145 – Please include this code in your message to me. Any message without this code will be deleted without being read. I apologize for this, but I am trying to filter out bots, spam, and offers from people who haven't even read the project details. Problem: I use Elementor Pro's native booking form on my pages, and it fits perfectly. However, on one specific page, the layout needs to accommodate multiple selections before the booking quote is submitted. This is the page: As you can see, I attempted to create
I'm seeking a talented designer well-versed in Corel Draw to elevate the design of my clinic's patient file. The aim is to make the design more professional and uniform, adhering to a modern and clean aesthetic. Key Modifications: - Color Scheme: Revamp the current palette to enhance visual appeal and consistency. (Medical sector blue color, or something good) - Typography: Improve text readability and overall design synergy. - Layout: Adjust the arrangement of elements for a balanced, uncluttered look. This project primarily involves redesigning a patient file, so experience in creating medical or similar professional documents would be an advantage. Please ensure your portfolio reflects your ability to create modern, clean designs. I want it in CDR forma...
I need a professional web developer to help me convert my current .aspx project website to PHP. The new site must be fully functional on a Linux Debian system. Key Requirements: - Extensive experience with both .aspx and PHP - Deep understanding of standard .NET frameworks, as the current site uses these - Proficient in MySQL, as this is the database system currently in use - Familiar with Linux Debian systems Please note that the functionalities of the current .aspx website were not specified, so the developer may need to reverse engineer some elements. A keen eye for detail and problem-solving skills will be essential to ensure a seamless transition.
I'm looking for a modern and sleek office image featuring our company logo. The design should prominently include: - Workstations and desks - A Conference room - A Lounge area The color scheme should be neutral tones - think whites, greys, and beiges. The ideal freelancer for this project should have experience in graphic design, particularly in creating corporate office images. Understanding of modern office layouts and aesthetics is crucial. Please provide examples of similar work in your proposal.
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
I need a PHP script that will read a JPG from a filename on disk, and upload it to various Amazon APIs - Use Amazon Rekognition to detect any adult content, and return a structure of detected objects and rating - Use Amazon Textract to identify and return any text present on the image. - Use Amazon S3 to store the image for public access, and return a public URL (with no expiration). - Add feature to PHP class to remove the image from Amazon S3 Deliverables: - PHP script to do all of the above (probably using cURL) requests, must be robust with error checking, and return a JSON structure with all relevant results from each API - Basic documentation to setup and secure the various Amazon services being used Ideal Skills: - Proficiency in PHP (no comopser being used, ver...
I'm looking for a freelancer to assist with data entry from spreadsheets into Microsoft Excel. The data is mixed, consisting of both text and numerical values. Ideal Skills and Experience: - Proficient in Microsoft Excel - Attention to detail - Experience with data entry from spreadsheets - Ability to handle mixed types of data (text and numerical)
I'm looking for a skilled video editor who can create a smooth reverse text mask effect in both Premier Pro and After Effects. Key Requirements: - Create a text transition effect over an image. - The text should smoothly transition, creating a seamless and professional looking effect. Ideal Skills: - Proficiency in both Premier Pro and After Effects. - Previous experience with creating text mask effects. - Strong understanding of video editing and transitioning techniques. Please provide examples of similar effects you've created in your proposals.
I have years of experience in Website management and SEO and have helped rank many sites(ranking guarantee in 60 days). I have a four-step process (SAVE hundreds in value with the best SEO on the net) ?1/. Increase URL rating - IF YOU? are looking at SEO services you need a good URL score ideally you want it to be a minimum of 60. You can not get the top 3 of Google searches without it. I Will Increase Your URL Rating 60+ Within 10-20 Days Guaranteed. I will also increase your Domain Aurthority to 40+ once the backlinks are indexed(MONTH 2 domain rating and trust flow) ?2/. Manual Easy to understand SEO Audit report Website audit is a must it will narrow down to the exact issues and save you Audit includes ● XML Sitemap Errors ● Robots' Errors ● Spam Score Checking and m...
I have created a voting system using HTML and JavaScript. I can save votes in local memory, but I need assistance to ensure votes are saved to a file correctly. Key Requirements: - Expertise in JavaScript and HTML - Experience with file handling in JavaScript - Problem-solving skills to identify and rectify mistakes in my code Your task would be to help me correct my current implementation so that votes are saved to a file whenever the form is saved, instead of being lost after the session ends. The current system saves votes in local memory, but I need your expertise to help me save them in a file instead.
I am looking for a talented Python developer to create an application that will run on a Raspberry Pi. This application will process the RTSP stream from an IP camera to find and read a digital weight display. Key Features: - The weight display is fixed in position, so the application will not need to track moving elements on the screen. - The application should perform Optical Character Recognition (OCR) on the display and store the results in a text file. - The whole system needs to function without any internet access. Web Interface: - A web page hosted on the Raspberry Pi will be used for testing and adjusting parameters. This includes tweaking OCR settings and viewing logs. - The application should also allow me to start and stop the video stream from the web i...
...banner should not copy this. Its simplicity and how it presents the info can be used as a guide. Perhaps a strong blue colour feature or element could be there as part of the design, not necessarily the entire slide. Perhaps a pace holder for an image that reflects the content of the video? Not sure A photo of me or the speaker: place holder Topic in clearly readable font, large enough for people read I should be able to change the video topic for each video. Others that are a bit more complex but still present the thumbnails in a clearly readable way are: @theschooloflifetv @AcademicAgent
...Native or bi-lingual ASP.NET experience essential - minimum 3 years .NET Core experience essential - minimum 3 years Proven work experience as a Mobile App Developer or Web App Developer. Experience with mobile and web development frameworks such as Ionic, React Native, Flutter, or Angular. Solid understanding of the full mobile and web development lifecycle. Proven experience as a Senior Web Developer / Front End Developer or similar role, with a strong portfolio of web development projects Expertise in modern web development technologies and frameworks such as JavaScript and React. Aware of best practices in implementing functionality into UI/UX design Desirable experience, an understanding of C#, ASP.NET, SQL and .NET Core for back-end integration. No a...
...Native or bi-lingual ASP.NET experience essential - minimum 3 years .NET Core experience essential - minimum 3 years Proven work experience as a Mobile App Developer or Web App Developer. Experience with mobile and web development frameworks such as Ionic, React Native, Flutter, or Angular. Solid understanding of the full mobile and web development lifecycle. Proven experience as a Senior Web Developer / Front End Developer or similar role, with a strong portfolio of web development projects Expertise in modern web development technologies and frameworks such as JavaScript and React. Aware of best practices in implementing functionality into UI/UX design Desirable experience, an understanding of C#, ASP.NET, SQL and .NET Core for back-end integration. No a...
I'm looking for a professional to create a SketchUp file for an architectural design project. The file should represent the basic layout and structure, without the need for detailed building features or high-detail furnishings. Ideal Skills: - Proficiency in SketchUp - Understanding of architectural design - Ability to create basic layouts Experience: - Prior work with architectural SketchUp files - Experience with creating models for conceptual planning or client presentations Please note, the primary purpose of this project is not yet determined, so flexibility and creativity in your approach will be highly valued.
Russian Recording Project We need Freelancers for long term Project. We have a project, that needs Native Russian speakers, we will give you the text, and you need to record 20 sentences. Every sentences is 2 word, you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is $1.5 dollar for 20 sentences record. Every sentences is 2 word If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the project. Thanks :
Portugal Portuguese Recording Project We need Freelancers for long term Project. We have a project, that needs Native Portugal speakers, we will give you the text, and you need to record 1000 Short sentences. you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is $20 dollar for 1000 sentences record. After you finished recording and then we will pay u 50%. after your checking done and then we will pay u remaining 50%. it will take time to check 5-7 days. If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the pr...
Project Title: Advanced Telegram File Uploader Bot Project Description: I want to create a Telegram file uploader bot with advanced features that allow the admin to upload single or multiple files and generate unique download links for users to access these files. Below are the detailed features and requirements: Core Features: 1. File Uploading: Single-file upload. Batch upload (multiple files at once). 2. Download Link Generation: The bot should generate unique download links for each uploaded file or batch. Links should allow users to download the files directly via Telegram. 3. File Management: The admin should have the ability to add files to an already uploaded batch. Admin should be able to modify or delete files and batches. ...
I have an Illustrator (AI) file that needs to be converted to a Corel Draw (CDR) file. The primary purpose of this conversion is for further editing, so it is crucial that all editable elements, like text and layers, are preserved in the process. Key Requirements: - Convert AI file to CDR format - Ensure all editable elements are preserved - Specific fonts and text styles must be retained The AI file contains specific fonts and text styles that need to be preserved in the CDR file. Please only apply if you have experience with both Adobe Illustrator and Corel Draw and can ensure a seamless conversion of the file without any loss of quality or functionality.
I need someone skilled in data entry to help with inputting mixed data (numerical and text) into an Excel sheet. The data needs to be organized in chronological order. I will provide a PDF with data that contains 4 fields to be entered on Excel document. Ideal skills for this project include: - Proficiency in Excel - Excellent attention to detail - Strong organizational skills Please note, there will be no specific date or time formats involved in the data entries.
I'm looking for a skilled Photoshop professional to help me with a project involving 16 short pages. The task is quite straightforward - I will provide the text and a layout guide, and I need you to simply place the text on each page according to the guide. Ideal Skills & Experience: - Proficient in Adobe Photoshop - Experience with page layout and design - Attention to detail - Ability to follow provided guidelines precisely
I'm in the process of creating three PDF brochures, and while the graphic design is already taken care of, I need assistance refining the draft text I've written. The goal is to transform the text into a friendly yet knowledgeable and reliable narrative, without resorting to hard-selling tactics. Key elements: - The tone should be friendly and conversational, appealing to potential clients. - The text should effectively communicate our expertise and knowledge, instilling trust and reliability. - The final product should be easy to read and informative, projecting a positive company image. Ideal candidates will have experience in professional proofreading and editing, with an ability to adapt to a specified tone and style. A background in copy...
I need an FPGA expert to create a system that scrambles/descrambles analog VGA NTSC/PAL video signals. The selected FPGA is iCE40HX1K (or iCE40HX8K) so...on our setup. We need somebody with previous experience with analog VGA NTSC/PAL signals and FPGA, so please state any relevant experience you have. The project will be split into multiple milestones to better track progress and assess if you will be able to complete the project, but you can propose a cost/time for the full project or split it into proposed milestones yourself. We need someone pro-active that will propose solutions to overcome any challenges we encounter and that can focus on this work (we don't want this project to take months). Please start your proposal with "VGA" to confirm that you ha...
Russian Recording Project We need Freelancers for long term Project. We have a project, that needs Native Russian speakers, we will give you the text, and you need to record 20 sentences. Every sentences is 2 word, you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is $1.5 dollar for 20 sentences record. Every sentences is 2 word If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the project. Thanks :
Portugal Portuguese Recording Project We need Freelancers for long term Project. We have a project, that needs Native Portugal speakers, we will give you the text, and you need to record 1000 Short sentences. you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is $20 dollar for 1000 sentences record. After you finished recording and then we will pay u 50%. after your checking done and then we will pay u remaining 50%. it will take time to check 5-7 days. If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the pr...
...operational performance. 5. CRM Integration • Customer Communication: o Automated email notifications for: Offer requests Booking confirmations Payment confirmations Travel reminders and vouchers Post-trip feedback requests (e.g., TrustPilot) • Data Consistency: o All customer and booking information feeds into a centralized CRM database. o Ensure accurate and consistent data across all processes. 6. Provider and Inventory Management • Hotel and Golf Contracts: o Upload net rates, booking conditions, seasonal pricing, and inventory details. o Manage inventory types (e.g., single rooms, suites, villas, green fees, tee times) with automation for availability and pricing updates. • Operational Booking: o Automate communication with hotels and gol...
I'm in need of a seasoned C#/.NET Full Stack Developer. Although specifics weren't mentioned, I'm open to discussing web application, desktop application, or API development. The ideal candidate would be proficient in: - C# and .NET Framework - Full stack development - API integration and development Experience with SQL Server, MySQL, or NoSQL databases would be beneficial. Please feel free to propose suitable frontend technologies, but proficiency in React, Angular, or Vue would be a plus.
''Please read details carefully before applying'' Experienced WordPress developer to design a responsive website using the BeTheme and BeBuilder. It is entire static website. NOTE: Only apply solo freelancers, agency/company should stay away Key requirements: 1. Complete design using BeBuilder with minimal CSS (no external plugins) =. We will do maximum changes within theme because premium access is available. 2. Ensure responsiveness on all devices. 3. Optimize website for high loading speed (green LCP & ACP). 4. Content will be provided; you’ll update it. 5. Consistent communication and updates throughout the project. 6. Strict deadline: 4-5 days. 7. For Design I have video recording of figma design and old exsisting website Only apply if you can...
I'm working on a project to try and help locate lost and stolen pets. I want to start by increasing the range of a pet microchip scanner to be able to read the microchip number from further away. The current range is only 8cm. I believe this can be done by increasing the size of the antenna and adding a stronger power source. Ideal skills and experience for this job include: - Knowledge of electronics and RFID - Knowledge of pet microchip technology
Dear Freelancers We need someone who can make a quick database for us We have invoice where you need to take infos from the client: -First name last name adress phone number -how much they spent over the years -number of the invoice and how much invoice they paid over the years too Invoices are .doc (so you can copy/paste) easily We give access to our Drop...they spent over the years -number of the invoice and how much invoice they paid over the years too Invoices are .doc (so you can copy/paste) easily We give access to our Dropbox From 2020 to 2024 there is around 1300 invoices You can do it on excel or something else if you have an other idea, we need something designed and easy to look at please Write elephant in your bid to show us that you've read what we need Need it...
I'm looking for a seasoned project manager/consultant to help me convert my current two-family home into a four-family residence. The responsibilities include: - **Approval Consultation**: Assist me in navigating the necessary zoning and permit approvals. - **Contractor Selection**: Help me review and select a qualified contractor, ensuring they meet budget, timeline, and quality standards. - **Project Oversight**: Monitor progress through different project phases, particularly during construction and building as well as finishing and inspection. - **Quality Control**: Ensure the use of high-quality materials and adherence to agreed-upon specifications. - **Regular Updates**: Provide ongoing status reports and flag any potential issues early for resolution until project ...
Hello there, We will translate your file from English to Russian, as discussed. Thank you!
Deploy this repo into vercel by deploying isnt working:
I possess a PDF manual for a brushless EtherCAT drive and I'm in need of a professional who can assist me in writing an ESI file (in XML format). This file should be created using the DVS P100E Servodrive as a template and incorporating key technical specifications from the manual. The final objective is to have a fully functional ESI file that can be used in TwinCAT or CoDeSys projects. Key elements to be included: - Communication parameters - Object dictionary - ESI XML The ideal freelancer for this project should have a strong understanding of EtherCAT drives, experience with creating ESI files, and proficiency in XML. Familiarity with the DVS P100E Servodrive would be a significant advantage. Your deep understanding and attention to detail will ensure that e...
I'm looking for a cross-platform mobile app (iOS and Android) that incorporates a virtual assistant with automated responses. The primary function of this virtual assistant would be to handle product information queries. Key Features: -Create AI agent that can browse the net looking for shopping deals - Designed for both iOS and Android platforms - Incorporation of a virtual assistant - Automated responses to product information queries - Ideal Skills and Experience: - Proficiency in cross-platform mobile app development - Experience with integrating virtual assistants in mobile apps - Solid understanding of automated response systems - Knowledge about product information query handling systems
I'm looking for a freelancer to transcribe a PDF file containing text only into a plain text file. This transcription should include the preservation of headings as they appear in the original document. A sample page is attached - the whole job is 28 pages like this one Ideal skills for this job include: - Attention to detail to ensure accurate transcription - Ability to recognize and replicate headings from the original document - Proficiency in creating and formatting plain text files
Greetings I am very much efficient at working on ............... Fashion clothing Design & tech pack ........................, , I have read your project description, & understand IT... I can help you with your design task which you are looking Toddler Tops & Bottoms Tech Pack Creation, . Please review my portfolio ................... ( https://www.freelancer.in/u/grapple2013 ) ....................... for a better understanding with better clarification. I have worked lot of satisfactory clients and still continue with them with a lot of project activities. I am always available to quickly with quality base deliverable work. Thanks, Sourav
