Vb net human resource management system punët
...of ways we can make the work even better but my main goal is to find someone at this stage who is simply capable of building something what the clients need. 3. I would want to work with someone who has a knowledge of seo and anything else that would enable to give our clients the best chance of their products and services being viewed and therefore used. 4. API integration. 5. An awesome human. I am working hard to move from a single person to an agency set up so to be frank, I need someone who is hardworking, reliable and also that is personable seeing as there would be a fair amount of communication. I’m not a big company so I need someone who gets what I’m trying to achieve and is on a similar wavelength. Lastly, I would want this to be done under a white ...
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
...spoken everyday. Availability: ASAP Main responsibilities: The ideal candidate is expected to carry out the following duties both in Russian language: Sales: first point of contact for advices and general enquiries from prospects: what products to buy, prices, offers, quotations, advises on design, colours, sizes, expected delivery times, guarantees, sales policies, etc… Order management: checking clients’ artwork, verifying colours, making graphic files quick fixes and modifications using Photoshop, coordination for the manufacturing and approval of samples Post sales support: helping customers solving problems with deliveries, tracking parcels online (EestiPost, Omniva, DPD, TNT, FedEx, UPS, etc…) handling issues reported by clients with p...
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui
nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui
Looking to develop a dynamic educational website similar to , focu...develop a dynamic educational website similar to , focused on providing practice tests for students. The website should allow kids to choose answers for multiple-choice questions and automatically display results similar to the functionality observed at Must be user-friendly, mobile-compatible, and equipped with a robust content management system to easily update and manage question sets. Key Features Needed: - User registration/login - Multiple choice question interface - Instant score display after test completion - Admin panel for managing questions and users - SEO optimized structure Required Skills: Web Development, PHP, HTML5, JavaScript, SEO
I'm looking for a proactive and imaginative Online Assistant to help with a variety of tasks. Your responsibilities will primarily revolve around managing various online administrative tasks. Key Responsibilities: - Email Management: Organizing, prioritizing, and responding to emails as necessary. - Data Entry: Accurately entering information into our systems. - Scheduling Appointments: Coordinating and scheduling meetings. Ideal Skills and Experience: - Proficiency in Microsoft Office Suite is a must. - Experience in the Education industry will be highly advantageous. - Strong organizational skills and attention to detail. - Ability to work independently and manage time effectively. - Excellent communication skills.
...Social Media Marketing: Illustrate our provision of tailored strategies for consistent growth and engagement across platforms. - Brand Reputation Management: Emphasize our expertise in restoring and maintaining a positive online presence for businesses. The design should be: - Visually appealing, bright and eye-catching yet aligned with a professional tone - Clear and easy to understand - Incorporating a strong call to action, such as "Contact us now for a complete transformation of your online presence!" Ideal skills and experience for this job include: - Proven experience in graphic design, preferably for social media - Understanding of brand management and growth strategies - Ability to create visually appealing and engaging content Let me know if you need ...
...that includes exclusive resources and articles - A library of downloadable guides as part of the exclusive resources The ideal professional for this project should have experience in: - Developing membership-based websites - Creating user-friendly, accessible web platforms - Implementing secure payment gateways - Designing engaging, easy-to-navigate resources The goal is to build a trustworthy, resource-rich site that can effectively support parents and caregivers of children needing special education. Kairos Advocacy & Mediation Our Advocates can help you with all of your child's learning differences and disabilities including IEP/504 Plan & Manifestation Hearings, and more! Monthly Membership for $49.95 a month gets you annual membership access of the followi...
...estimating system for a new consulting venture. The software, developed in the year 2000, is built on MS Excel and MS Access and used for BioPharma, Power and other industrial capital project estimating. Key Tasks: - Make the existing system operational with current MS Applications - Ensure seamless data import from Excel to Access - Retain and improve the existing functionality of generating Estimate reports - Potentially transitioning it to a web-based system with custom client opening page graphic The ideal candidate should have: - In-depth knowledge of MS Excel and MS Access - Experience in working with legacy systems - Ability to design user-friendly data entry forms - Entrepreneurial spirit and willingness for a face-to-face collaboration Your expertise wil...
...packaging options. Value-Add Section: Expand your packaging program with: Stretch wrap, bubble mailers, and industrial drums. Freight services that integrate seamlessly with your supply chain. Full-service warehousing and pallet management. Call to Action: ? Call Jeremy at xxxxxxx to streamline your packaging and shipping! Flyer 4: Warehousing Solutions Headline: "Your Supply Chain’s Best Friend – Flexible Warehousing Services!" Core Focus: Short- and long-term storage options in secure facilities. Drop trailer programs to streamline operations. Inventory management tailored to your business needs. Value-Add Section: More than just warehousing: Comprehensive pallet and packaging solutions. IBC totes, bulk bags, and industrial drums. Recycling and...
I'm looking for a professional to manage my TikTok ads for a few weeks. My budget is €200. The primary goal of this campaign is to drive sales for my physical products, specifically targeting teenagers and young adults. Your responsibilities will include: - Strategizing and optimizing ad placements to reach my target audience effectively - Creating compelling ad content that resonates with teenagers and young adults - Monitoring ad performance and making necessary adjustments to maximize ROI Ideal candidates should have: - Proven experience managing TikTok ads - A creative mindset with the ability to create engaging ad content - Strong understanding of the buying behaviors of teenagers and young adults - Excellent analytical skills to assess ad performance and strategize accord...
I'm looking for a C# developer to create a basic color mixing program using Windows Forms and the .NET framework. This simple application should utilize the standard primary colors, with 6 radio buttons (red, blue, yellow) for color selection. Key Features: - Upon selecting a color from each of the three sets and clicking 'Mix', the background changes to reflect the newly mixed color. - An option to reset the colors to their default state. - An exit button to close the application. The color mixing process should be visualized as an instant change upon clicking 'Mix'. Ideal Skills: - Proficiency in C# and .NET Framework. - Experience with Windows Forms applications. - Ability to create simple, user-friendly interfaces. -If you need an idea of what...
...that are crucial for the smooth operation and growth of my Amazon business. Key Responsibilities: - Inventory Management: Ensure stock levels are optimal, forecast future inventory needs based on sales trends, and manage reorders. - Order Processing: Monitor order flow, ensure timely dispatch, and handle any issues that may arise during the order process. - Customer Service: Provide excellent customer service by addressing queries, resolving issues, and managing feedback. - Advertisement: Develop and implement effective advertising strategies to enhance product visibility and increase sales. Ideal Skills: - Strong understanding of Amazon Seller Central - Excellent inventory management skills - Proficient in order processing - Exceptional customer service skills - Experi...
I'm a freelancer in search of a tailored project management dashboard. The primary users will be project managers, so the dashboard must cater to their specific needs. Ideal Skills and Experience: - Proficiency in project management software development. - Strong understanding of project management principles. - Experience in developing user-friendly interfaces. - Ability to incorporate features for tracking, budgeting, and team collaboration. Note: The project management features to be included will be decided based on mutual discussions.
I'm looking for an SEO expert who can help boost my website's visibility, and increase traffic. The website is ...website is designed to generate leads and sales through service descriptions and products that can sourced for clients. Key Requirements: - Proven experience in SEO, particularly for service-based websites. - Ability to create strategies aimed at increasing website traffic. - Understanding of lead generation and e-commerce. -Milestone will be release after work is done after the first 30 days (Net 30) Please note, I skipped the question regarding my current lead generation channels. However, I am open to recommendations on how to enhance my lead generation and sales through other channels such as social media, email marketing and paid advertising. Freelanc...
I'm looking to set up a GTA RP server on FiveM tailored for India. The server will focus on delivering a realistic role-play experience, with several key features integrated for immersive gameplay. Key Features to Implement: - A comprehensive Economy System - A detailed Law Enforcement System - A range of Custom Jobs Ideal Skills: - Proficiency in FiveM server scripting and management - Experience with creating immersive, realistic role-play environments - Knowledge in implementing intricate game systems such as economies and law enforcement If you have a passion for gaming and possess the required technical skills, let's collaborate to create an engaging and fun server for the GTA RP community in India.
...position ) Required Skills & Experience Required Profile 7+ years of experience on Database warehouse / lake house programming Experience in implementing at least 2 end-to-end data warehouse / data lake projects Experience in implementing at least 1 Azure Data warehouse / lake house project end-to-end Converted business requirements to concept / technical specification Worked along with source system experts in finalizing ETL and analytics design Support data modeler developer in design and development of ETLs Creation of activity plan as per the agreed concept with timelines Technical Expertise: Strong experience with Microsoft Azure components, including Azure Data Factory, Azure Synapse, Azure SQL Database, Azure Key Vault, MS Fabric, Azure DevOps (ADO), and Virtual Netw...
Skills required: Experience as a software d...o-31-5-inches/rog-swift-oled-pg27aqdp/ LAST REQUIREMENTS: 6)The tool must also be able to run(and be able to set it to run) in the background without closing itself off unless you go on the system tray and manually close it. The tool should work fine in windowed, fullscreen windowed and especially in fullscreen exclusive mode. Desktop and outside of the game so that i can always have it on, have a startup exclusion so it can load in while turning on the pc. Some aesthetic to make the tool pretty and menu management to make it easy to understand and accessible. The tool must not trigger any anticheat nor contrast with any softwares like riva tuner statistics, nvidia or any app that can record the screen.
...and remove domains in bulk - Move domains between different portfolios - Name portfolios (e.g., Generics, traffic, jamesdomains, etc.) - Import domain name revenue for cost comparison - Add domain name costs per extension (e.g., .com, .net, .xyz, etc.) to monitor yearly costs of each portfolio - Export files per portfolio, as well as a global export - Backup daily and send via email The script should use a simple Username & Password authentication method. The ideal freelancer for this project should have prior experience in domain management and web script development. Knowledge of domain valuation and renewal processes is a plus. The script should allow for import/export in CSV and Excel formats. I'm open to additional features you may suggest ba...
Scope of Work: Payment Solution for CFD Platform in Africa We are seeking quotes from payment specialists to design, build, and implement a seamless payment solution for a CFD trading platform targeting the following African countries: Nigeria, Ghana, Uganda, Cameroon, and Zambia. The system should enable real-time deposits and withdrawals for clients, routing funds to and from international bank accounts. Scope of Work 1. Payment Gateway Integration: • Integrate localized payment methods (cards, bank transfers, and mobile money) for each target country using PSPs • Ensure real-time processing of deposits and withdrawals. 2. Currency Conversion & Settlement: • Implement a currency conversion mechanism to support deposits in local currencies and settle funds...
I need assistance in implementing Microsoft policies for our computers. The primary objective is to restrict local file saving and enforce that all files are saved on OneDrive. We want to be able to manage these policies remotely. Ideal Skills and Experience: - Extensive knowledge and experience with Microsoft in...implementing Microsoft policies for our computers. The primary objective is to restrict local file saving and enforce that all files are saved on OneDrive. We want to be able to manage these policies remotely. Ideal Skills and Experience: - Extensive knowledge and experience with Microsoft intune admin panel - Expertise in creating and managing IT policies - Demonstrated ability to implement remote management capabilities - Understanding of OneDrive functionalities an...
My name is Elan and I'm the owner of the Cromwell Manor Inn, a 13-room Inn in Cornwall, NY, just 60 miles north of NYC in the ...for our busy season. Background: While I’ve run small ad campaigns on Google, Facebook, and Instagram (spending about $100-$150/month), they haven’t made much of an impact. I’ve also tried backlink building and keyword research through freelancers without noticeable results. I'm hoping to see a significant change with your expertise. Skills and Experience: - Proven track record in Google Ads management, particularly within the hospitality industry. - Strong understanding of targeting and reaching leisure travelers. - Ability to provide clear, actionable advice and support. - Experience with improving off-season occupancy in a ...
I need assistance with my website. It's experiencing some design and layout issues that need to be addressed. Tasks Include: - Fixing broken links or elements - Updating text and images on the site Ideal Skills: - Web Design - HTML/CSS - Content Management - Problem-solving I'm seeking a freelancer with a keen eye for design, technical expertise, and a knack for troubleshooting to enhance the overall functionality and aesthetics of my site. I need to update some pages and add a few new pages. I have all the photos and content, I just do not know how to add it with website Powered by wordpress· Designed with the Customizr theme
Looking to develop a dynamic educational website similar to , focu...develop a dynamic educational website similar to , focused on providing practice tests for students. The website should allow kids to choose answers for multiple-choice questions and automatically display results similar to the functionality observed at Must be user-friendly, mobile-compatible, and equipped with a robust content management system to easily update and manage question sets. Key Features Needed: - User registration/login - Multiple choice question interface - Instant score display after test completion - Admin panel for managing questions and users - SEO optimized structure Required Skills: Web Development, PHP, HTML5, JavaScript, SEO
I'm seeking a professional to manage my Facebook and Instagram accounts, create promotional materials, and organize contacts to help my small business attract more clients and save time. I need someone who can start ASAP. Please include relevant experience in your application.
I'm looking to add a Social Login feature to my existing Nuxt project. The login options should include Google and KeyCloak (OIDC). Key Requirements: - Implement Google and KeyCloak (OIDC) as the Social Login options. - Retrieve the user's Email, Full Name, and Profile Picture dur...Requirements: - Implement Google and KeyCloak (OIDC) as the Social Login options. - Retrieve the user's Email, Full Name, and Profile Picture during the login process. - Store this user data in my database. Ideal Skills: - Proficient in and its ecosystem. - Experience with integrating Social Login features. - Familiarity with Google and KeyCloak (OIDC) services. - Competent in database management and user data storage. Please, if you have the relevant skills and experience, I look fo...
I'm looking for a skilled data engineer/ data scientist to create a web-based link for reporting that can be used by executives. This application should generate various crucial reports including: - Financial reports - Performance reports - Resource Utilization - Revenue Forecast The ideal candidate should be able to integrate data visualization features in the form of charts and graphs, dashboards, and interactive elements. Experience in creating similar web-based applications will be highly advantageous. This project is aimed at enhancing decision-making processes, so an understanding of executive needs in reporting is a plus. We are considering to use Power Bi for reporting and there is potential source data hosted at AWS SERVER. I would like to have technical roadmap on h...
I'm looking for a talented PowerPoint designer to create a colorful and creative presentation for my Environmental Science project on Waste Management, focusing on the 5Rs. The presentation consists of 17 slides, and I will provide detailed content for each slide. Your tasks will include: - Compiling and organizing the provided information - Designing the slides in a 'Creative and Colorful' style - Sourcing and incorporating relevant images or graphics for visualization The ideal freelancer for this project should have: - Proven experience in creating visually appealing PowerPoint presentations - Ability to understand and translate complex information into engaging visual content - Excellent communication skills for liaising and clarifying content as necessary I&r...
I am in need of an experienced PHP Full Stack developer to help create a custom WordPress-based Content Management System (CMS). Key Responsibilities: - Design and implement a WordPress CMS tailored to my specifications. - Integrate essential features such as user roles and permissions, content scheduling, and SEO tools. Ideal Candidate: - Proficient in PHP and full stack development, with a strong background in WordPress. - Experience in creating custom CMS and integrating complex features. - Expertise in SEO tools and content scheduling systems. - Ability to design and implement secure user roles and permissions. This is a great opportunity for a seasoned developer who can deliver a high-quality, user-friendly CMS.
I'm in need of an expert to set up a robust communication and authentication system for both my websites and mobile apps. This system should encompass: - Email Integration: Setting up email login for user authentication. - SMS Verification: Implementing SMS based verification for added security and user verification purposes. - Push Notifications: Enabling push notifications to keep users informed and engaged. The ideal candidate for this project should possess extensive experience in integrating these services and ensuring they function seamlessly across both platforms. A strong understanding of security protocols and user engagement strategies would be beneficial.
...Textbox for minimum % profit, excluding all others. Implement profitably of trade with total cost of trade, including gas fees. Possibly implement triangular trade analysis for obscure trading opportunities. Stage 2 (Implementation of trades): Wallet code for trading. Implement buying and selling of identified pairs within/across exchanges and blockchains. Stage 3 (More Complex system) Smart contract, not executing if no profit. Take advantage of gas tokens, flash loans, mempool transaction replacement, and trade batching (wrapping multiple trades across one or more DEXes into a single transaction). Protect from the negative effects of MEV (like front-running or price manipulation). Implement triangular trade analysis for obscure trading oppo...
I'm in need of a seasoned full stack developer specialized in Laravel and Vue for creating a custom web application with a primary focus on data analytics and reporting. Key Responsibilities: - Develop a robust custom web application - Implement user management features - Integrate data analytics and reporting functionalities - Ensure seamless integration with various data sources Ideal Skills: - Proficiency in Laravel and Vue - Extensive experience in REST API development - Strong background in data analytics and reporting - Skilled in working with databases (e.g., MySQL, MongoDB) and APIs (e.g., REST, GraphQL) The project will involve integrating with multiple data sources, including databases and APIs. Experience with external data sources such as CSV and Excel will also...
...host or XX and XX hosts / max allowed connections / bouqet asignment - Fingerpint send line text or able to use to use username to show on the streams of userline. - Transcoding profiles hevc/h264 - stream management, overview see stream status,bitrate/acodec/vcodec/format/total connections to channel, uptime channel, channel shour url Creating stream, selecting profile for transcoding, and all metrics of ffmpeg optimized options multi source option also for streams. - Nginx config/ port hls rtmp settings port settings password settings security etc reload without restart - Bouqeet management, create categorys for channels add them in side this categorys, edit category remove channel add channel. - Live connections > show connected users,, and channels what are restream...
I'm looking for a versatile worker to join our expanding team. Since 2009, we've been in the industry and now we're broadening our horizons. The ideal candidate should be proficient in a range of tasks, with a particular emphasis on Google Ads management and SEO. Key Responsibilities: - Overseeing and managing our Google Ads campaigns. - Conducting keyword research and optimization. - Implementing on-page SEO techniques. Skills and Experience: - Proven track record in Google Ads management. - Experience in keyword research and on-page SEO. - Versatile worker able to handle multiple tasks. - Prior experience in an ongoing SEO support role would be an advantage.
I am in need of a .NET developer with good knowledge of .NET app and web server. We need to get a new desktop software developed that will do autofill and automatic work on the booking website
I'm looking fo...and Android. Key Features: - User Profiles: Users should be able to create and manage their own profiles. - In-App Purchases: The app should support seamless in-app transactions for purchasing diamonds. - Ratings and Reviews System: Implement a system for users to rate their purchases and leave reviews. Payment Integration: - The app should integrate with PayPal as the primary payment gateway. Ideal candidates for this project should have extensive experience in developing cross-platform apps, especially marketplace apps. A deep understanding of user profile management, in-app purchase systems, and implementing rating and review systems is crucial. Experience with integrating PayPal is a plus. Please provide examples of your previous work that...
...software for houseboat business 1. Lead Management Lead capture from various sources (website, social media, email, phone calls). Lead categorization (e.g., hot, warm, cold). Automated follow-up reminders and tracking. Integration with email/WhatsApp for communication. Analytics on lead conversion rates. 2. Housekeeping Management Task assignment and tracking for housekeeping staff. Real-time status updates (clean/occupied). Inventory of housekeeping supplies. Maintenance request escalation for damages or issues. 3. Maintenance Management Scheduled maintenance tracker for boats and equipment. Maintenance request logging and resolution tracking. Maintenance expense recording. Alerts for periodic inspections or regulatory checks. 4. Food & Beverages (F&B) M...
I'm looking for a highly organized and reliable virtual assistant to provide administrative support for my business. The ideal candida...organized and reliable virtual assistant to provide administrative support for my business. The ideal candidate will have excellent communication skills, attention to detail, and the ability to handle a variety of administrative tasks efficiently. Key Responsibilities: - Email management - Data entry - Designing posters Communication Tools: - Email - Instant messaging apps Update Frequency: - Bi-weekly Ideally, the freelancer will have: - Strong organizational skills - Proficient in data entry and email management - Basic design skills for posters - Excellent communication skills - Attention to detail - Ability to handle a variety o...
...Advanced where the password management system is not enforcing the password complexity rules as per the set policy. In TIA Portal Runtime Settings under User Administration, when we enable the options for password complexity requiring "Must include numbers" and "Must include special characters," the system accepts passwords without alphabetic characters. For example, a password like 1234567@ is accepted, even though we expect the password to include alphabetic characters as well (e.g., Abc@123). Our requirement is to enforce passwords that include: At least one uppercase letter, At least one lowercase letter, At least one number, and At least one special character. Please, your expertise can help restore the system's integrity and ensu...
I'm seeking a Google Sheets/Forms specialist to refine our current diary management system for a dynamic event space and business. Key Responsibilities: - Enhance the usability of our existing Google Sheets systems - Integrate Booking Forms into Google Sheets for seamless data flow - Consolidate various data sources including Event Bookings, Customer Information, Customer Contracts, and Invoice Tracking Ideal Skills: - Expert in Google Sheets and Forms - Previous experience with diary management systems - Strong User Interface Design skills - Data consolidation proficiency Your role would be to streamline our current system and make it more user-friendly. I look forward to your proposals.
We need a full service email marketer or an agency who can run our Klaviyo account for us. Replace outdated flows and send campaigns. Our brand is rooted in the deep and emotional bond between a human and their dog. We and our customers understand that dogs are more than pets, their are part of our family. This makes copywriting and designing email content for our brand uniquely challenging - you can't get away with simple AI generated stuff, it needs to have soul, the creator of our emails needs to understand how to connect to dog owners, and also be an expert in Klaviyo. Hopefully we can get all of that at a decent budget, especially we are looking to work out some sort of a hybrid deal since Q1-Q3 is slower for us vs Q4 we scale up the business up to 10-fold so yeah ...
I'm seeking a professional to post health-related educational content on my social media platforms for a duration of three months. This involves posting on YouTube, Instagram, and Facebook. Key Responsibilities: - Regularly posting health-focused educational videos on my social media platforms - Optimizing the posts for each platform Ideal Skills: - Proficiency in social media management - Understanding of health-related content - Experience with educational content promotion If you have a passion for health education and a knack for social media, I'd love to hear from you.
...delivery, audience preference management, automated workflows, survey and form submission capabilities, and real-time tracking of interactions to optimise campaign performance. By capturing and analysing engagement data instantly, the platform will enable us to drive positive communication outcomes, streamline feedback collection, and gain valuable insights for refining our messaging. This aligns with CITB’s commitment to data-driven decision-making and a customer-focused approach, ensuring every interaction contributes to an improved communication strategy and customer experience. Our current provider is used as the digital marketing tool to leverage communications (multichannel) to employers, training groups, and adhoc learners that exist in our CRM eco system (...
Looking for a Real Estate Administrative Assistant. We are a canadian real estate agency seeking a skilled Administrative Assistant to join our team on a freelance basis. This remote position will support our team by managing data entry, contract drafting, Online Listing Management, Client Database Maintenance, assisting with email campaigns, and handling social media content creation and postings. The ideal candidate will be organized, reliable, and able to perform routine tasks efficiently. Requirements: Proven experience in administrative support or a similar role. Familiarity with real estate terminology and basic processes is preferred. Competency in Microsoft Office applications, such as Outlook, Word & Excel, and experience with social media platforms (Meta Business Sui...
...Dolibarr module creation and ERP system integration to build a custom module that connects Dolibarr with Nexus ERP via API. The goal is to synchronize critical data and streamline collaboration between the two platforms, focusing on efficient management of financial and operational documents. Functional Requirements: Types of Data to be Synchronized: Customer and Supplier Invoices: Retrieve issued and received invoices from Nexus ERP and store them in Dolibarr. Generate invoices in Dolibarr and send them to Nexus ERP. Consumption Vouchers: Import consumption vouchers from Nexus ERP for management in Dolibarr. Create and update consumption vouchers in Nexus ERP via Dolibarr. Delivery Notes: Fetch delivery notes from Nexus ERP into Dolibarr for transport manageme...
1. Map Out and Create Operations Process Flows for All Supply Chain Activities Objective: Develop a comprehensive framework of supply chain workflows to identify inefficiencies and optimize performance. Steps to Complete: Activity Identification: Document end-to-end processes, from procurement to final delivery. Categorize into strategic (forecasting), operational (inventory management), and tactical (order fulfillment) processes. Stakeholder Input: Interview teams across procurement, warehouse, and logistics to uncover process pain points. Visual Mapping: Use tools like Lucidchart or similar, to create process flows, highlighting financial metrics such as cost-per-shipment, inventory holding costs, and waste percentages. Performance Metrics: Include lead times, error rates,...