Sms api fro vb net punët
...to work with someone who has ideas of ways we can make the work even better but my main goal is to find someone at this stage who is simply capable of building something what the clients need. 3. I would want to work with someone who has a knowledge of seo and anything else that would enable to give our clients the best chance of their products and services being viewed and therefore used. 4. API integration. 5. An awesome human. I am working hard to move from a single person to an agency set up so to be frank, I need someone who is hardworking, reliable and also that is personable seeing as there would be a fair amount of communication. I’m not a big company so I need someone who gets what I’m trying to achieve and is on a similar wavelength. Lastly, I would ...
api intigrate karani hain plese contect me 9837194609
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Dalam dunia slot online yang semakin berkembang pesat, pemain selalu mencari platform yang dapat memberikan keuntungan besar dan pengalaman bermain yang menyenangkan. Salah satu situs yan...transaksi. 4. Cara Mendaftar di Idola69 Bergabung dengan Idola69 sangat mudah. Berikut adalah langkah-langkah untuk mendaftar: Kunjungi Situs Resmi Idola69: Pastikan Anda mengakses situs resmi untuk mencegah penipuan. Isi Formulir Pendaftaran: Lengkapi data diri yang dibutuhkan, seperti nama, alamat email, dan nomor telepon. Verifikasi Akun: Setelah mengisi formulir, Anda akan menerima email atau SMS untuk verifikasi akun. Deposit: Setelah akun terverifikasi, lakukan deposit pertama untuk mulai bermain. Mulai Bermain: Pilih permainan slot favorit Anda dan rasakan sensasi kemenangan dengan winra...
I am in search of a seasoned developer with extensive experience working with the Meta API for Facebook and Instagram. The primary purpose of this project is to utilize the API for data analysis and reporting, specifically focusing on user engagement metrics. Key Responsibilities: - Analyze user engagement metrics using the Meta API - Develop a dashboard for data presentation Ideal Skills: - Proficient with Meta API - Strong experience in data analysis - Skilled in dashboard development The data should be presented in a user-friendly dashboard. This is a crucial part of the project, so prior experience with dashboard creation is highly desired. I look forward to receiving your bids.
I'm seeking a Python expert to help me prepare for an upcoming interview focused on Python API Development. The primary purpose of the API I'm working with is for data retrieval, but I also need to understand data submission and third-party integration. Key Areas of Focus: - **Technical Skills**: I need to enhance my technical skills, particularly in understanding and working with Python APIs. - **Programming Languages**: A significant part of the interview will focus on my knowledge of various programming languages, with a primary emphasis on Python. Ideal Skills: - Extensive experience in Python and API development. - Strong understanding of various programming languages. - Proven track record of interview coaching or training. - Ability to explain compl...
I'm looking for a comprehensive financial model template for analyzing potential multifamily investment properties. The model should be suitable for use with an LLC and accommodate optionality for multiple partners, as I plan to go in on properties with several investors. Key Requirements: - Essential forecasting metrics: Include Cash Flow Analysis, Net Operating Income (NOI), Internal Rate of Return (IRR), 3-statements, return metrics, and a structure that can handle distributions to multiple equity investors. (my experience is fairly limited here, so I may want something in here to help better analyze deals that I'm not currently aware of and could use someone's expertise.) - Financial Statements: Income Statement, Balance Sheet, and Cash Flow Statement should be ...
I'm in need of an experienced AWS DevOps Engineer to assist in setting up our API Gateway and configuring a WebSocket connection for our chat application. Key Responsibilities: - Setting up API Gateway - Configuring a WebSocket connection (WSS) - Integrating with Lambda - Implementing authentication using API Gateway authorizer Ideal Skills and Experience: - Hands-on expertise in AWS services - Deep understanding of API Gateway, Lambda, DynamoDB, IAM, and WebSocket protocols - Prior experience with real-time chat applications Please note: We specifically need help with setting up the authentication for the WebSocket connection using API Gateway authorizer.
...Implement a WhatsApp-based communication system to improve daily interactions and project workflows within our team. - Scope of Work: * Set up WhatsApp Business API or appropriate version for business communication. * Create guidelines for internal messaging, including response times, message formatting, and usage protocols. * Develop a task coordination process that leverages WhatsApp features, ensuring all team members are aligned and accountable. * Integrate a project management approach using WhatsApp capabilities to monitor progress and share updates efficiently. - Ideal Candidate: * Experience with WhatsApp Business API or other communication tools integration. * Strong understanding of internal communication strategies. * Proficient in project...
I'm looking for a skilled developer with experience working with API integrations, particularly with Wix and third-party platforms. The task involves creating a simple HTTP POST API request that will send specific contact information from my Wix site to the Plezzel real estate lead capture platform. The data to be transmitted includes: - Name and email - Phone number An essential part of the job is ensuring data validity before transmission. You will need to implement a data validation process to filter out any incorrect or incomplete information. Ideal candidates should possess: - Strong understanding of HTTP requests - Experience with API integrations, particularly with Wix and third-party platforms - Ability to ensure seamless data transmission - Proficiency...
I'm looking for a skilled developer experienced in .NET, HTML, and CSS to address few issues in a web application for me. Skills and experience ideal for this job: - Proficiency in .NET, HTML, and CSS. - Experience in developing web applications. - Familiarity with implementing user authentication and payment integration. - Previous work with content management systems. - React Js knowledge is optional, but a plus.
...needs to process all images and videos (including pfps and cover photos) with the userID of the person viewing it. There should be some database to avoid reprocessing data for viewers who see the same things repeatedly, like pfps for example. There needs to be a progress bar showing how long it will take to process videos, because some of those will take along time. It will need to use a API to handle these processing jobs faster, because with many users there will be too much processing.) 3. Signup/login flow changes with toggle and popup 4. Sumsub integration: Right now new users upload an ID and a selfie and one other document. That goes into a dashboard that I will then use to put the photo uploads into sumsub to verify the IDs. I need the sumsub integration to be aut...
I'm looking for a talented developer who can create an interactive chatbot for automating customer interactions in my perfume business. The bot should assist customers in selecting products, processing orders, and providing delivery information. Key Requirements: - The bot should communicate using text and images - It should be available on various platforms including my website, social media (...(like Facebook and Instagram), and popular messaging apps (like WhatsApp and Telegram) - The bot needs to be multilingual, capable of supporting three or more languages Ideal Skills: - Proficiency in chatbot development - Experience with e-commerce automation - Skills in creating visually engaging content for bots - Multilingual programming experience - Knowledge of popular messaging platfo...
...(e.g., self-catered or premium). Date, time slot, and add-ons (e.g., decorations, catering). Automatic cost calculation based on customer selections. 3. Customer Data Collection and Marketing Integration: Data Collection: Gather customer details (name, email, mobile number, preferences, and purchase history). Store data securely for future use. Marketing Integration: Enable targeted email and SMS campaigns based on customer data. Create customer segmentation for customized deals (e.g., frequent visitors, birthday clients). Include analytics to track booking trends and customer behaviour. 4. Technical Recommendations: Option 1: WordPress with Plugins Use WooCommerce Bookings or Amelia for booking features. Use plugins like Mailchimp for marketing automation. Pros: Cost-effectiv...
I'm seeking an experienced iOS developer to create an iPad app that connects to an API for managing both user check-in and waiver signing. Key Features: - User Authentication: Users should authenticate themselves via a unique QR code, with their names or reservation number - Check-In Process: The app should manage user check-in seamlessly, if there is a payment pending they have to go on the counter. - Waiver Signing: Post check-in, users should be redirected to the waiver signing page. - Confirmation Messages: A confirmation message should be displayed after successful check-in. Ideal Skills: - iOS Development: Proven experience in developing iPad applications. - API Integration: Expertise in connecting apps to APIs. - QR Code Scanning: Previous work implementing uni...
*BUDGET IS MAX 220*. (IF YOUR ESTIMATE IS ABOVE PLEASE DONT CONTACT) PRIME EXAMPLE IS : PRODUCT WILL TRACK MULTIPLE PREVALENT DIESEASES NOT ONLY COVID. Job Proposal: AI Dashboard for Disease Outbreak Prediction Project Ove...future. Budget Breakdown (Approx. $200): AI Model Development: ~$100 This includes the basic machine learning model development, training with WHO datasets, and integration into the dashboard. Dashboard Design and Development: ~$60 This includes the creation of the user interface, integration of features (graphs, disease predictions, alerts), and deployment on a web platform. Data Preprocessing and API Integration: ~$40 This includes the preparation and cleaning of WHO datasets and integration of data sources into the dashboard..
I'm searching for a skilled Laravel developer to finalize our Legal Management System. This is an opportunity to work on a unique project with substantial potential. Key Responsibilities: - Completing frontend development: The UI needs to be intuitive and user-friendly for legal professionals. - Enhan...manage case files, documents, billing information, etc. Ideal Skills and Experience: - Extensive experience with Laravel framework - Previous work on developing or improving a legal management system - Strong skills in frontend development, particularly with creating intuitive UIs - Expertise in backend programming and database management - Experience in e-commerce, content management systems or API backend services can be a plus - Ability to deliver high-quality work within a...
I'm seeking an experienced developer with a strong background in implementing user authentication, E-commerce with Stripe integration, and API integration with Appwrite. This project involves working with some design guidelines and branding material I have, so an eye for design would be beneficial. Key Responsibilities: - Integrate Stripe for E-commerce payments - Connect with Appwrite for backend services - Work within provided design guidelines and branding material Ideal Skills and Experience: - Extensive experience with - Proven track record with Stripe payments integration - Familiarity with Appwrite - Strong understanding of user authentication systems - Design sensibility and experience working with design guidelines - Excellent communication skills for remote colla...
...troubleshooting and resolving a specific issue on our platform. Project Scope: Diagnose and resolve a 404 Not Found error during OAuth2 credential callback within n8n workflows. Ensure proper configuration of n8n OAuth2 callbacks, URLs, and relevant API integrations. Test and verify functionality to ensure smooth and reliable operation. Provide guidance or documentation for the implemented solution. Requirements: Proven experience with n8n workflow automation platform setup, maintenance, and troubleshooting. Strong understanding of OAuth2 protocols and API credential management. Familiarity with reverse proxy configurations (e.g., NGINX) and debugging 404 errors. Ability to communicate technical solutions effectively and deliver results promptly. Additional Information:...
...Django Python developer to integrate the WhatsApp API into a customer support system. This system will manage customer queries with preset responses based on the type of user inquiries. Key Features: - Handle diverse queries: The system should be capable of addressing services inquiries, technical support questions, and general information requests pertaining to the service - Automatic Query Categorization: I require the system to automatically categorize incoming queries for efficient response managemen and generate relevant response. - Multi-Platform Synchronization: Besides WhatsApp, the system responses should be synchronized with Email, SMS, and Web chat. Ideal Skills: - Proficiency in Django and Python - Experience with WhatsApp API integration - Knowledge ...
I'm seeking a proactive professional for outbound prospecting on behalf of my marketing company. The task involves using a designated email address to connect with specific brands and target audiences. Key Responsibilities: - Prospecting CPG Brands, Retail, Travel, Finance, and Consumer Facing companies with a net revenue of over 5M. - Targeting key decision-makers, including Brand Managers, Directors, Marketing Managers, Promotions Managers, and Assistant Brand Managers. - Setting up meetings using Microsoft products. Skills and Experience: - Prior experience in outbound marketing or prospecting. - Proficiency with Microsoft products. - Access to a current list of relevant brands. - Excellent communication skills, with the ability to convincingly represent our company. - ...
...notification preferences, such as how often they receive alerts or whether they receive alerts only for high-risk actions (e.g., visiting dangerous websites or downloading suspicious files). Lightweight and optimized for performance. Easy-to-use UI/UX for non-technical users. Seamless Integration with Reliable Cybersecurity APIs: Incorporate trusted cybersecurity APIs like Google Safe Browsing API for real-time URL reputation checks. Ensure smooth and timely data retrieval from these services to offer immediate feedback to the user. Deliverables: Fully functional Chrome extension (.crx and source code). Clear setup and user documentation. Basic testing for reliability and performance. Budget: $200-250 Timeline: 4-7 weeks Ideal Candidate: Experience developing Chrome Extens...
I need a freelancer who can help me with bulk domain search using the API. This is a straightforward task that I need to be completed today. Familiarity with the API and experience in conducting bulk domain searches would be ideal.
I'm seeking a developer to create an external system for managing a unidirectional synchronization between our main system (an AI bot simulating a digital assistant) and various calendars (Google Calendar, Apple Calendar, and CalDAV). Key Responsibilities: - Receive data from our main system via an API. - Synchronize this data with linked calendars. - Implement a resynchronization feature accessible from both the API and a web interface. Ideal Candidate: - Proficient in API integration - Experienced with Google Calendar, Apple Calendar, and CalDAV - Capable of synchronizing events, reminders, and tasks. Please note, the system's primary role will be to sync events, reminders, and tasks from our main system to the linked calendars. Spanish-speaking profi...
We ...functional multi-chain arbitrage bot with a user-friendly web interface. • Documentation detailing setup, usage, and configuration. • Regular updates and support during the development and testing phases. Ideal Candidate: • Proven experience in building arbitrage bots or similar blockchain applications. • Strong knowledge of blockchain networks and DEX protocols. • Experience working with API integrations and node services like Alchemy, Infura, Ankr, and GetBlock. If you’re up for the challenge and can deliver a high-performance arbitrage bot, please submit your proposal with: 1. Your experience in building similar projects. 2. Estimated timeline and cost. 3. Any questions or suggestions regarding the project scope. Let’s build s...
...app should have secure and user-friendly interfaces for different types of users, namely Master Distributors, Distributors, and Retailers. - Recharge Services: The core functionality of the app will be to facilitate recharge services. - API Integration: The app should have seamless API integration to ensure smooth operations and connectivity. - UPI Integration: A crucial part of this project is the integration of UPI for easy and secure transactions. Ideal Skills and Experience: - Proficiency in Android and Web app development. - Extensive experience in API and UPI integration. - A strong understanding of creating multi-tier user access applications. - A commitment to creating a secure and user-friendly interface. The goal is to create a comprehensive, secure, and...
I am ...functional system. • Customized CRM with unnecessary modules removed and necessary features added. • Consistent design and seamless user experience. • Documentation for any custom code or configurations. Skills Required: • Laravel framework expertise. • Experience with CRM systems, preferably ERPGo. • Proficiency in database design and optimization. • Strong understanding of UI/UX principles. • API development and integration experience. Note: Both the Laravel website code (Apexa theme) and ERPGo CRM code will be provided to the developer. Please share your experience, relevant portfolio, and a brief plan for how you will approach this project when submitting your proposal. Looking forward to working with a skilled professio...
I'm looking for a developer to create a program that will help in organizing and setting up an es...file containing the picture and value of each item. In terms of eBay integration, the program should interface with eBay for the auction of selected items. This includes: - Listing items for auction - Tracking bids - Managing payments The ideal candidate for this project should have extensive experience in software development, particularly for cross-platform applications. Familiarity with eBay's API and auction mechanics would be advantageous. Please ensure to include relevant examples of your work in your proposal. I want to be able to print to a label printer with either a bar code or qrc. Also want to be able to do a sorted print to show all items, auction items, indi...
Se necesita integrar una API externa con un sitio web en Wordpress, con el fin de extraer datos de esta API y mostrarlos en una sección de la web. Los datos son referentes a propiedades que ya están cargadas en esta API, y se deben extraer datos relevantes como nombre de propiedad, precio, cantidad de dormitorios, superficie e imagen referencial, para luego dar la posibilidad de cotizar la unidad seleccionada.
...React, Vue.js, or Angular. Cloud Hosting: AWS, Google Cloud, or similar services. Integration with relevant APIs (e.g., Meta API for future upgrades). Milestones UI/UX Design Approval: Create and finalize wireframes or design mockups. MVP Development: User account setup with profile details (photo, logo, and phone). Basic templates for graphic creation and direct sharing to Facebook/Instagram. Enhancements to MVP: Add media library functionality. Implement additional features based on initial user feedback. Additional Requirements Clean, well-documented, and scalable code. Support and bug fixes after the initial launch. Future upgrades (optional): Integration with Meta API for running paid campaigns. Lead management system to collect and track leads from campaigns. Ques...
...Bundler Bot that will streamline transaction processes for freelancers and developers alike. What We Need: ? Solana Expertise: You have hands-on experience with Solana blockchain development, smart contracts, and transactions. ? Bundling Functionality: Build a bot that can bundle multiple transactions into a single transaction to reduce gas fees and improve processing speed. ? API Integration: Create an easy-to-use API to allow developers to integrate the bundler bot seamlessly into their existing projects. ? Scalability: Ensure the bot is scalable and can handle large volumes of transactions with high reliability. ? Security: Implement strong security measures to ensure the bot works safely with user funds and sensitive data. Skills Required: ⚡ Deep understanding of Sol...
react expert for small task I need react expert that can read parameters from a url that willl trigger the react app, like in this case read id and pass to the app when opening for customization. its not open the app and call a api after. the app must be trigger already with this paramter passed using json for customization of the first page.
I need an experienced developer to connect the ActiveNet API to my WordPress website. The website posts classes as custom post types. The integration should allow the ActiveNet API to create and delete classes on the website as they are updated in ActiveNet. Specific Requirements: - Connect class schedules and class details from ActiveNet. - Update existing class information on WordPress as it changes in ActiveNet. - Evaluate the need for custom fields or specific attributes in class posts. Ideal Skills: - Proficiency in WordPress and WordPress custom post types. - Extensive experience with API integration, particularly ActiveNet. - Ability to assess and implement necessary custom fields. Time is of the essence, so I would appreciate it if this could be done as so...
...token payments on the Reef Chain. This application aims to deliver a smooth payment experience for customers while empowering merchants with complete control over their cryptocurrency transactions through self-custody wallets. Required Skills & Experience - Strong proficiency in JavaScript and TypeScript - Proven experience in building Shopify applications and a solid understanding of Shopify's API - Expertise in GraphQL - Familiarity with blockchain technology and Web3 integration - Experience working with cryptocurrency payment systems - Knowledge of React and Node.js - Understanding of smart contract interactions and blockchain oracles Project Scope Core Features 1. Payment Processing - Integration with Reef Chain for processing REEF token payments - Real-time paym...
I'm seeking a seasoned w...per their trading needs, with the primary focus on showcasing main market depth across all stocks with specific features. - Utilization of Specific Financial API: The project will leverage the Angel Broking Smart API () for data sourcing. - Comprehensive Market Depth Page: The main market depth page should incorporate a liquidity heatmap, real-time price updates, depth data, and the contribution of stocks to indices. Ideal candidates should have: - Extensive web development experience. - In-depth knowledge and experience working with financial APIs, particularly the specified Angel Broking Smart API. - Proven skills in creating interactive, real-time data visualization tools. - Experience in developing user-customizable dashboards.
To effectively display real estate listings on your website using the MLSGrid API, follow these steps based on the information available from various sources: Understand the MLSGrid API: The MLSGrid API provides a standardized, RESO-compliant method for accessing real estate listings from multiple MLSs through one data feed and license agreement. This reduces the complexity of managing data from various sources. API Integration: API Key and Agreement: First, you'll need to secure an API key from MLSGrid, which involves agreeing to their licensing terms. This key allows access to the listing data. RESO Web API: Use the RESO Web API standard for data retrieval. This API is designed to be more efficient for real estate dat...
I need a skilled developer to connect the MLSGrid API to my Houzez Real Estate Theme. The purpose is to display property listings in real-time. Key Requirements: - Connect MLSGrid API to Houzez Theme - Display of property listings - Real-time updates of listings Key Details: - The MLSGrid API should be configured to display property listings, with a specific focus on price and location, as well as photos and virtual tours. - The listings should be updated in real-time, providing potential buyers with the most current information. Ideal Skills and Experience: - Proficiency in working with APIs, particularly MLSGrid API - Experience with Houzez Real Estate Theme - Knowledge of real estate data and property listings - Able to ensure real-time updates without la...
...history application in Java. This app should closely resemble the default Android call history interface. Key Features: - A search function to easily find specific calls - Call statistics to provide insight into calling habits - An icon for each call that represents the first letter of the contact's name -Upon clicking one entry, the entry should expand and show more options like add contact, sms, etc as seen with default android call history app project needs to be done in android studio using Java, using latest versions of the tools. need to handover the entire codebase from android studio. The ideal candidate will have: - Extensive experience in Android app development - A strong understanding of Android's design principles - Ability to implement interactive and ...
Ju lutemi Regjistrohuni ose Identifikohuni për të parë të dhënat.
...Client communication tools Required Functionality: Custom WordPress theme WooCommerce customization User role management Secure file handling Payment gateway integration Email automation Analytics tracking Upsell conversion tracking Technical Scope: WordPress + WooCommerce Custom dashboard development Database optimization Security implementation Performance optimization Mobile responsiveness API integrations as needed Deliverables: UX/UI designs for all pages Fully functional WordPress website Custom client dashboard Integrated upsell system Admin management panel Documentation Training session 30 days support Process Management: Initial consultation and requirement gathering UX/UI design approval Development milestones Testing phase Launch preparation Go-live support Po...
I need a skilled Python developer to help me with some data processing and scrapping tasks. The dat...processing. Key Responsibilities: - Develop (and/or replicate existing) Python code for data processing - Implement data transformation techniques - Use data filtering methods to refine the data Ideal Skills and Experience: - Proficiency in Python - Experience with data processing and transformation - Familiarity with data filtering techniques - Ability to handle text and numerical data - Google API Personality : - No Toxic - Collaborative - Responsive, agile and fast work delivery Budget: $5/code from scratch $50 for replicating the whole data processing steps check here :
Integration Custom API Management Form with Infolaftsearch
...server DB, with provided design and data. - Using DONT net framework 8, JavaScript, AJAX, and , without the use of BI tools. - Ensuring high performance and an excellent interface focused on superior UI/UX. - Creating multiple models based on available indicator data. - Allowing user interaction to select sectors, indicators, and filter by regions and years. - Providing flexibility for users to change chart types from linear to bar, pie charts, and others. The primary purpose of this dashboard is for thorough data analysis. It will be used by analysts, managers, and the general public, so it needs to be intuitive and accessible. Ideal skills for this job include: - Extensive experience with SQL server DB. - Proficiency in DONT net framework 8, JavaScript, AJAX, and Char...
Subscription-Based Website with TradingView Integration 1. Project Title Build a Secure Subscription Website with TradingView API Integration and DRM Video Hosting 2. Overview I am looking for a developer or team to build a secure, user-friendly subscription-based website. The platform will provide exclusive access to invite-only TradingView indicators and DRM-protected learning videos. It must include automated subscription management, content security, and a personalized dashboard for users. The goal is to create a professional and scalable platform for my subscribers. 3. Core Features User Authentication Secure login/signup functionality. Two-factor authentication (optional). Subscription Management Monthly and yearly subscription plans. Payment gateway integration (Razorpay, P...