Send bulk sms gsm modem vb net codeproject punët
I need someone in Tirana to visit several shopping malls and send me some pictures and information. More info after I award the project. It will be one off visit, and not more than 10 pictures. Kam nevojë për dikë në Tiranë për të vizituar disa qendra tregtare dhe për të më dërguar disa fotografi dhe informata. Më shumë informacion pasi të jap çmimin e projektit. Do të jetë një vizitë dhe jo më shumë se 10 fotografi.
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
miredita shqipe pom duhet me qu shum emaila ndoshta munt te mundesh mem ndimuu te pershendes me tmira
Dalam dunia slot online yang semakin berkembang pesat, pemain selalu mencari platform yang dapat memberikan keuntungan besar dan pengalaman bermain yang menyenangkan. Salah satu situs yan...transaksi. 4. Cara Mendaftar di Idola69 Bergabung dengan Idola69 sangat mudah. Berikut adalah langkah-langkah untuk mendaftar: Kunjungi Situs Resmi Idola69: Pastikan Anda mengakses situs resmi untuk mencegah penipuan. Isi Formulir Pendaftaran: Lengkapi data diri yang dibutuhkan, seperti nama, alamat email, dan nomor telepon. Verifikasi Akun: Setelah mengisi formulir, Anda akan menerima email atau SMS untuk verifikasi akun. Deposit: Setelah akun terverifikasi, lakukan deposit pertama untuk mulai bermain. Mulai Bermain: Pilih permainan slot favorit Anda dan rasakan sensasi kemenangan dengan winra...
I'm looking for a comprehensive financial model template for analyzing potential multifamily investment properties. The model should be suitable for use with an LLC and accommodate optionality for multiple partners, as I plan to go in on properties with several investors. Key Requirements: - Essential forecasting metrics: Include Cash Flow Analysis, Net Operating Income (NOI), Internal Rate of Return (IRR), 3-statements, return metrics, and a structure that can handle distributions to multiple equity investors. (my experience is fairly limited here, so I may want something in here to help better analyze deals that I'm not currently aware of and could use someone's expertise.) - Financial Statements: Income Statement, Balance Sheet, and Cash Flow Statement should be ...
...communication system. Key Responsibilities: - Build a stable VOIP system and software phone compatible with macOS and Linux. - Connect the system to multiple SIP trunk providers and GSM device gateways for line stability. - Assist in finding and connecting to a suitable SIP trunk service provider. - Undertake system maintenance post-construction. - Provide a detailed work plan and quotation for long-term cooperation. Ideal Skills & Experience: - Extensive experience in VOIP system construction. - Proficiency in building software phones compatible with macOS and Linux. - Ability to connect to multiple SIP trunk providers and GSM device gateways. - Knowledge of SIP trunk service providers. - Strong system maintenance skills. Please note, the technician will play a le...
I'm looking for a skilled developer experienced in .NET, HTML, and CSS to address few issues in a web application for me. Skills and experience ideal for this job: - Proficiency in .NET, HTML, and CSS. - Experience in developing web applications. - Familiarity with implementing user authentication and payment integration. - Previous work with content management systems. - React Js knowledge is optional, but a plus.
...(e.g., self-catered or premium). Date, time slot, and add-ons (e.g., decorations, catering). Automatic cost calculation based on customer selections. 3. Customer Data Collection and Marketing Integration: Data Collection: Gather customer details (name, email, mobile number, preferences, and purchase history). Store data securely for future use. Marketing Integration: Enable targeted email and SMS campaigns based on customer data. Create customer segmentation for customized deals (e.g., frequent visitors, birthday clients). Include analytics to track booking trends and customer behaviour. 4. Technical Recommendations: Option 1: WordPress with Plugins Use WooCommerce Bookings or Amelia for booking features. Use plugins like Mailchimp for marketing automation. Pros: Cost-effectiv...
Project Description: I am seeking a skilled professional in cybersecurity and mobile app development to create a highly secure communication system designed to protect all communications from surveillance or interception. Key Features of the Project: 1. Secure Device: Customization of a smartphone to operate only via Wi-Fi. Disabling unnecessary features such as GPS, camera, microphone, and cellular modem. Customizing the operating system (e.g., GrapheneOS or CalyxOS) to prevent unauthorized modifications. 2. Custom Communication App: A messaging app similar to WhatsApp featuring: Encrypted text messages. Multimedia file sharing. Secure audio calls. Peer-to-peer communication only (no intermediate servers). Implementation of advanced end-to-end encryption. 3. Anonymous and S...
I am looking for a skilled Django Python developer to integrate the WhatsApp API into a customer support system. This system will manage customer queries with preset responses b...capable of addressing services inquiries, technical support questions, and general information requests pertaining to the service - Automatic Query Categorization: I require the system to automatically categorize incoming queries for efficient response managemen and generate relevant response. - Multi-Platform Synchronization: Besides WhatsApp, the system responses should be synchronized with Email, SMS, and Web chat. Ideal Skills: - Proficiency in Django and Python - Experience with WhatsApp API integration - Knowledge in developing automated categorization systems - Familiarity with multi-platform synch...
I'm seeking a proactive professional for outbound prospecting on behalf of my marketing company. The task involves using a designated email address to connect with specific brands and target audiences. Key Responsibilities: - Prospecting CPG Brands, Retail, Travel, Finance, and Consumer Facing companies with a net revenue of over 5M. - Targeting key decision-makers, including Brand Managers, Directors, Marketing Managers, Promotions Managers, and Assistant Brand Managers. - Setting up meetings using Microsoft products. Skills and Experience: - Prior experience in outbound marketing or prospecting. - Proficiency with Microsoft products. - Access to a current list of relevant brands. - Excellent communication skills, with the ability to convincingly represent our company. - ...
I need a freelancer who can help me with bulk domain search using the API. This is a straightforward task that I need to be completed today. Familiarity with the API and experience in conducting bulk domain searches would be ideal.
...to support an initial product catalog of approximately 500 SKUs, with the ability to scale to 1,000+ SKUs over time. 2. Custom Features • Enable secure customer login accounts with role-based pricing for specific customers. • Develop a bulk-ordering system with functionality to offer free units for large purchases instead of percentage discounts. 3. Product Management Assistance • We will provide product images and text content. • We will assist with uploading the initial SKUs to expedite the process. • Ensure the platform includes features for bulk uploading and editing SKUs (e.g., via CSV files or inventory integration) to allow us to independently add new SKUs as inventory becomes available. 4. UI/UX Design • Design a clean, profes...
Hey Guys, We are looking for someone to research keywords on different niches. You will be provided with - - Niche of the site - A brief description of the niche - 6 Main Categories of the Niche site we'll be building (You can suggest improvements) These are for brand new websites - so your research should encompass the same. We want the following - - 500 Keywords Per Category Total - 3000 Keywords We want low competition, high to mid traffic keywords. Cluster where needed, we don't want keyword repetition at all. We want to avoid keyword cannibalization at any cost. You can use Ubersuggest, Ahrefs or Semrush Keyword Magic. We will require a detailed colour spreadhseet containing the search terms and data in easy to understand format, each column should list the keywor...
I need assistance with changing the creation date of a large number of image files. Currently, I have approximately 38,000 images stored on an external drive. The task involves replacing the 'Created' date with the 'Modified' date. An ideal candidate for this project would have: - Experience with file management and data processing - Proficiency in handling large quantities of files - Knowledgeable in using external storage devices - Attention to detail to ensure accuracy in the date changes I look forward to collaborating with a professional who can help me with this task.
...history application in Java. This app should closely resemble the default Android call history interface. Key Features: - A search function to easily find specific calls - Call statistics to provide insight into calling habits - An icon for each call that represents the first letter of the contact's name -Upon clicking one entry, the entry should expand and show more options like add contact, sms, etc as seen with default android call history app project needs to be done in android studio using Java, using latest versions of the tools. need to handover the entire codebase from android studio. The ideal candidate will have: - Extensive experience in Android app development - A strong understanding of Android's design principles - Ability to implement interactive and ...
...server DB, with provided design and data. - Using DONT net framework 8, JavaScript, AJAX, and , without the use of BI tools. - Ensuring high performance and an excellent interface focused on superior UI/UX. - Creating multiple models based on available indicator data. - Allowing user interaction to select sectors, indicators, and filter by regions and years. - Providing flexibility for users to change chart types from linear to bar, pie charts, and others. The primary purpose of this dashboard is for thorough data analysis. It will be used by analysts, managers, and the general public, so it needs to be intuitive and accessible. Ideal skills for this job include: - Extensive experience with SQL server DB. - Proficiency in DONT net framework 8, JavaScript, AJAX, and Char...
...correctly displayed in the appropriate menus. All data is centralized in Odoo. Access with different roles/access matrix is configured. Test to Perform: Verify that each module is activated in Applications. Create a product and ensure it appears in Sales, Purchases, Inventory, and Point of Sale. Test stock management by adding and removing items from the stock via Stock and Inventory. Add products in bulk to Odoo. Configure the PDA to scan items. 3. Configuration of Cash Registers and Payment Methods Requirement: Configure 3 Point of Sale (POS) registers for our store with the following options: Communication with cash drawers, payment terminals, ticket printing, and barcode scanning. Example: Each register should have its own configuration with a payment terminal (Visa, MasterCa...
I'm looking for a skilled .NET developer to create a web application focused on employee recognition. The app should primarily support a rewards and incentives system. Key Features: - A comprehensive rewards and incentives system: This will be the core functionality of the application. - Integrated access to rewards: Users should be able to access rewards through a points system and also directly selecting rewards. Both methods should be seamlessly integrated. Rewards: - The primary type of reward will be gift cards. The system should be designed to accommodate this type of reward. Ideal Skills: - Proficiency in .NET and experience in web application development is crucial. - Prior experience in developing recognition or rewards-based systems will be a significant adv...
Workflow Designer Module for electronic Form System Description: We are developing a e Form System using .Net Core and MSSQL. We need a drag-and-drop workflow designer where admins can visually design workflows with nodes, conditions, and actions for different approval processes. The module needs to integrate with our existing system and allow calling existing functions based on actions taken in the workflow. The workflow designer should closely follow the reference images provided. The designer will allow creating, editing, and processing workflows that involve multiple roles and approval stages. Features Required: 1. Drag-and-Drop Designer: - Ability to drag and drop nodes to create workflows. - Connect nodes to form logical paths (e.g., start, decision points, approvals, end)....
...name: - Develop an analog of the platform Project Goal: To create a web platform that allows to users to buy liquidated and surplus goods through online auctions, or price ( buy it now ). - Target audience: Resellers, owners of online stores, Entrepreneurs looking for bulk purchases of goods. 2. Main objectives: - Development of a user interface similar to - Uploading of goods to our site should be done automatically, through parsing of goods items on the site of our supplier. . Parsing should be done daily. Old (not current) product positions
We are in need of a professional SMS Gateway using a SIM box. The primary purpose of this SMS Gateway is to handle transactional messages. This system should also be able to integrate with our mobile apps for customer support. Key Requirements: - Development of an SMS gateway that can handle both inbound and outbound messages. - Integration of the SMS gateway with our mobile apps for customer support. - Optimisation of the system for transactional messages. Ideal Skills: - Proven experience in developing SMS gateways. - Proficiency in working with SIM box technology. - Strong skills in mobile app integration. - Capability to handle both inbound and outbound message processing.
I need specific modifications on my web-based POS system, which runs on the LAMP stack. Here are the tasks: - Remove unnecessary items from the sidebar - Eliminate print labels, barcodes, SKU, tax-type, SMS, and address from the interface - Get rid of the purchase return report invoice and unit cost display - Restrict cashier from altering discounts on goods during sales The ideal freelancer for this task should have: - Proficient knowledge and experience with LAMP stack - Prior experience customizing web-based POS systems - Ability to implement restrictions and modifications in the system Please ensure to detail similar past projects in your proposal. Thank you. BUDGET IS $10, ONLY BID IF YOU ACCEPT THAT MONEY BUDGET IS $10, ONLY BID IF YOU ACCEPT THAT MONEY BUDGET IS $10, ONLY...
I'm in need of a freelancer who can assist with bulk PDF data entry. The data could come from any source, including scanned documents, digital text files, or handwritten notes. The PDFs could contain any combination of text, images, tables, and charts. Ideal skills and experience for the job: - Proficiency in Adobe Acrobat - Excellent attention to detail - Ability to work with diverse types of data - Experience with data entry from various sources
I'm seeking assistance to delete a series of genuine negative Google reviews that could potentially harm my business's reputation. The reviews are not fake, but are genuine feedback from customers. Despite their authenticity, I feel it is necessary to remove them en masse for the sake of my company's image. Key Requirements: - Experience with Google review management - Proven track record of helping businesses protect their online reputation - Ability to handle the task in a timely manner Please note, I am not looking to address the feedback or keep the reviews. I need a professional who can efficiently handle this situation, allowing me to maintain my business's reputation without the concern of damaging feedback.
...Real-time synchronization with popular OTAs like , Airbnb, Expedia, Agoda, and more. Two-way data sync (retrieving bookings and updating availability). Inventory Management: Centralized dashboard to manage room availability and allotments. Automated updates to avoid overbooking and underbooking. Pricing Management: Dynamic pricing tools to adjust rates based on demand and seasonal trends. Bulk updates for multiple channels. Booking Management: Consolidated booking view with details from all connected channels. Automated notifications and booking status updates. Reporting & Analytics: Insights on occupancy rates, revenue trends, and channel performance. Customizable reports for operational decision-making. User Roles and Permissions: Role-based access control for property...
...Real-time synchronization with popular OTAs like , Airbnb, Expedia, Agoda, and more. Two-way data sync (retrieving bookings and updating availability). Inventory Management: Centralized dashboard to manage room availability and allotments. Automated updates to avoid overbooking and underbooking. Pricing Management: Dynamic pricing tools to adjust rates based on demand and seasonal trends. Bulk updates for multiple channels. Booking Management: Consolidated booking view with details from all connected channels. Automated notifications and booking status updates. Reporting & Analytics: Insights on occupancy rates, revenue trends, and channel performance. Customizable reports for operational decision-making. User Roles and Permissions: Role-based access control for property...
Hey Guys, We are looking for someone to research keywords on different niches. You will be provided with - - Niche of the site - A brief description of the niche - 6 Main Categories of the Niche site we'll be building (You can suggest improvements) These are for brand new websites - so your research should encompass the same. We want the following - - 500 Keywords Per Category Total - 3000 Keywords We want low competition, high to mid traffic keywords. Cluster where needed, we don't want keyword repetition at all. We want to avoid keyword cannibalization at any cost. You can use Ubersuggest, Ahrefs or Semrush Keyword Magic. We will require a detailed colour spreadhseet containing the search terms and data in easy to understand format, each column should list the keywor...
I'm seeking a seasoned Odoo developer for a **one-time basic setup** of important pages for a B2B e-commerce platfo...Development module to meet our specific requirements. - Integrating payment gateways, user management, and basic order tracking within Odoo. - Designing a professional, corporate-style SEO-friendly structure with smooth UI/UX. The primary purpose of this setup is to provide a foundation for streamlining our B2B sales across the country. Essential features include: - Basic order management. - Bulk ordering inquiry form. - Customer account creation and management. A proven track record in setting up functional B2B websites or portals with Odoo, along with excellent UI/UX design skills, is crucial for this project. Future enhancements will be added...
...Full Stack Developer for B2B Gift Card Platform with Admin and Client Dashboards Description: We are seeking an experienced Full Stack Developer to help build and optimize a B2B gift card platform where clients can access discounted gift cards through third-party API integrations. Our platform will provide both admin and client dashboards with payment options such as UPI and IMPS/NEFT/RTGS for bulk orders. The project involves backend API development, integration with third-party gift card providers, and creating a seamless frontend experience. Key Responsibilities: and optimize APIs for seamless third-party integrations (gift card providers). secure and scalable admin and client dashboards. dynamic API switching and failover mechanisms for API reliability. 4
...our existing .net core application, , into Flutter. This transition aims to consolidate our codebase for mobile, tablet, desktop, and web platforms. Before you apply, I recommend signing up for our product and familiarizing yourself with its features, including Board, Grid, Gantt, Notebook, Automation, and Workflow. In your BID, please include a list of Flutter packages you would use to replicate these features. This project is expected to be long-term, as we will need continuous support post-development. Key Application Features: - Primarily designed for mobile, Tabs, Desktop and Web platforms Ideal Skills: - Proficient in Flutter with at least 3 years of hands-on experience - Strong understanding of project management app development - Experience in .net core to Flut...
We are seeking a skilled web designer and developer with expertise in modern UI/UX design, SEO optimization, and responsive web development to redesign our website—World-Text.com. The goal is to create a modern, visually appealing, and user-friendly website that effectively highlights our core services: Bulk SMS, Two-Way SMS, and Developer APIs. Technical Requirements: Frontend: ReactJS and NextJS for dynamic and SEO-friendly rendering. Backend Integration: PHP-based API (existing backend)—connect to mock/stub or non-production API environment during development. Database Compatibility: Use APIs to connect to backend MySQL database where mock/stub API provision may not be possible. Version Control: GitHub (preferred for free-tier accessibility and collab...
I'm seeking a professional who can create an XSS (Cross-Site Scripting) testing script for my C# .NET application. The script should be able to test various components of the application to ensure security and robustness against potential XSS vulnerabilities. Key Areas for Testing: - User Input Forms - Comment Sections - Search Bars Types of XSS Attack Vectors: - Stored XSS - Reflected XSS - DOM-based XSS User Inputs to be Tested: - Text Fields - File Uploads - Rich Text Editors The ideal candidate should have extensive experience in web application security testing, particularly with XSS vulnerabilities. A deep understanding of C# .NET is crucial, along with the ability to create comprehensive testing scripts. Prior experience with testing user input forms, comment ...
I'm seeking an experienced CEO for my AI startup. The ideal candidate should have a strong background in the USA and European markets, with a proven track record of revenue generation. Key Responsibilities: - Prioritize revenue generation from scratch - Develop sales personnel - Collaborate with business heads like CEO,purchase manager,product manager - Collaborate with high-net-worth individuals (HNIs) - have the caliber to generate 10 millions USD revenue without spend. Expected Strategies: - Implement zero dollar marketing - Build strategic partnerships - Expand market presence in USA - Utilize a readymade database of HNIs Skills and Experience: - Extensive knowledge of the USA and European markets - Proven experience in a CEO role - Strong network of HNIs - Proficient i...
As the owner of a home cleaning company, I'm in need of a robust Desktop CRM software. The software should primarily manage customer relationships, tracking customer profiles and history, and facilitating automated communication via emails and SMS. Key Features: - Customer Profiles and History: The software should maintain comprehensive profiles of all our customers, detailing their cleaning history, preferences, and feedback. - Automated Communication: The system should be capable of sending scheduled emails and SMS to our customers, providing updates, reminders, and promotional content. Ideal Skills and Experience: - Proven experience in software development, particularly in creating CRM systems. - Strong understanding of customer relationship management. - Experie...
...with QR codes. Donation Management: Donation receipts with QR codes. Accept donations via payment gateways (Razorpay or PhonePe). Cash donation management with QR-coded receipts. Visitor Engagement: Ability to issue certificates with QR codes to visitors. Option for visitors to donate without membership. Communication Tools: Admin messaging system for members. Notice-sending feature (individual or bulk). Reports & Audits: Generate member reports. Upload yearly account and work audit reports. User Management: Block, unblock, or deactivate members. Membership validity system. Panels: Admin Panel, User Panel, and Manager Panel. Language Translation: English and Hindi language options. Website Content & Updates: Content creation, image updates, and project galleries. Social M...
I'm looking for a professional with extensive experience in Microsoft Access to help upgrade our existing 32-bit database to a 64-bit version. The main purpose of this upgrade is to enhance compatibility with our operating system and eliminate ongoing issues. Key Requirements: - Upgrade the database to 64-bit - Ensure the new version wor...compatibility issues - Prior experience with database security measures - Excellent troubleshooting skills for potential compatibility issues with third-party software or database files. Please note: The key goal of this project is to eliminate current compatibility issues. Copy of existing DB and forms will be provided. Deliverable is a full copy of replacement database, forms and associated VB/.Net code. Data migration not r...
I'm facing critical user authentication issues with my ASP.NET Zero application. The problem manifests as login failures affecting all users without exception. This is a critical issue that needs to be resolved promptly to restore system functionality and user access. Ideal Skills and Experience: - Extensive experience with ASP.NET...authentication issues with my ASP.NET Zero application. The problem manifests as login failures affecting all users without exception. This is a critical issue that needs to be resolved promptly to restore system functionality and user access. Ideal Skills and Experience: - Extensive experience with ASP.NET Zero - Proficient in troubleshooting user authentication issues - Strong background in .NET development - Able to deliver solutions promptly ...
...working on forensic image analysis, specifically focused on detecting tampering or manipulation in images. My primary goal is to create a robust detection system capable of identifying various tampering techniques, including: - Copy-move tampering - Computer-generated alterations - AI-generated content I have been using the CATNET model from this repository: While it performs well in some cases, it struggles with lower-quality images, even when tampering is visually noticeable. Despite experimenting with threshold values and optimizing the repository code, the desired results remain elusive. You can find the reference images I am working with here: The image names
I'm looking for a seasoned .NET/C# developer to improve a Windows desktop application designed for data management. Key Responsibilities: Analyze and optimize existing data structures Debug and resolve issues with current components. Write clean, maintainable code with proper documentation. Ideal Skills: Proficiency in .NET and C# Previous experience with Windows desktop application development Familiarity with modular class library development. Experience in software development with a focus on data analysis, storage, and visualization Debugging and testing skills. Good understanding of version control Please provide examples of relevant past projects in your proposal.
... Pusher: A service for real-time messaging and push notifications, including in-app messaging. 4. Marketing & Automation: Mailchimp: A widely used email marketing and automation platform to send newsletters, personalized emails, and manage email campaigns. HubSpot: A full-stack marketing automation tool to create email campaigns, segment user lists, and track marketing performance. Klaviyo: An email and SMS marketing platform designed to integrate with eCommerce apps and offer advanced segmentation. MoEngage: An omnichannel marketing automation tool that enables push notifications, email marketing, SMS, and in-app messaging. 5. Monetization & Ads: AdMob by Google: A mobile advertising platform to monetize your app by showing ads and generating revenue. Faceb...
I'm looking for a skilled C++ programmer experienced with MultiCharts and .NET to create a pair of scripts for trade copying. This project involves copying market orders, limit orders, and stop orders from a master account to several slave accounts on the same instrument. Key features to include: - Slave account-specific sizing based on a fixed ratio - A watchdog-like feature that manages rogue trades. This feature should be able to either close these trades immediately with an alert, or just alert without closing. You will need to: - Understand how to set up the scripts to accommodate different sizes for each slave account while maintaining a fixed ratio to the master account. - Implement a reliable watchdog feature that will monitor trades and handle any discrepancies betwe...
I am seeking a freelancer who can find 10 expired domains for me. The domains must meet the following criteria: - A Moz Domain Authority (DA) score of 55 or higher. - A spam score of less than 10%. - Domain extensions can be .com, .net, .org, or .info. I am not concerned if the authority has been artificially increased via Google redirects. In terms of deliverables, I would like a screenshot from Moz for each domain that shows the DA and spam score, with the domain name hidden. Once I have ten suitable domains, I will conclude the project and award £15 for each domain. To confirm - the total budget is £150. Please note, I will report any freelancer who adds placeholders to claim a split of the prize if unawarded.
I need assistance in organizing my Outlook contacts. I have a named contact list that contains between 50 to 200 contacts. Requirements: - Add these contacts to a group in Outlook for bulk emailing. - Include only the name and email of each contact in the group. No other details or notes are required. - The contacts should be grouped randomly. Ideal Skills: - Proficiency in Microsoft Outlook - Experience in managing contacts and creating groups - Attention to detail
we have an annoying popup when our windows 11 operating system loads. we need this error fixed uninstalled or removed. error message below See the end of this message for details on invoking just-in-time (JIT) debugging instead of this dialog box. ************** Exception Text ************** : The type initializer for 'App1.a' threw an exception. ---> : Could not load file or assembly ', Version=, Culture=neutral, PublicKeyToken=30ad4fe6b2a6aeed' or one of its dependencies. An attempt was made to load a program with an incorrect format. ---> : Could not load file or assembly '489472 bytes loaded from Qndmgaeq, Version=1.15.4.0, Culture=neutral, PublicKeyToken=null' or one of its dependencies. An attempt was made to load a program with an incorrect fo...
