Graphics based seat reservation system vb net punët

EDIT: Please ignore the pricing I chose, I am looking to agree either a monthly ongoing retainer or a per site cost but that is too difficult to gauge without actually speaking with you. Hello, I have my own little business creating and building brands for clients. I have been offering a 360 service including branding, graphics, websites, social media and top level conceptualisation of companies, services and products as a whole and seems to be going well but I am only one person and starting feel swamped. I am starting to think about trying to turn my business into an agency of sorts and am looking to extend my team and improve the quality of my service / output.l which in term would also allow me to start to take on a more overarching creative role and take on more clients. ...

...photos that explain the products and services of the company; - create the "gallery" page with all the best photos; - create the "contact" page with contact form and Google map; - possibly insert links to the social pages; - possibly arrange photos (with photoshop or other software) to adapt them to the theme and positioning; - use company colors as much as possible for the various texts, menus, graphics, etc. Work is expected to range between 10 and 20 hours. Maximum budget 100 euros. वर्डप्रेस के साथ इतालवी में एक शोकेस साइट बनाएं। हमारे पास सभी सामग्री (पाठ, फ़ोटो और एक मसौदा लोगो) है। मुझे क्या चाहिए: - हमारे द्वारा खोले गए डोमेन पर इतालवी में वर्डप्रेस स्थापित करें; - हमारे द्वारा अनुशंसित थीम और विभिन्न प्लग-इन स्थापित करें; - हमारे द्वारा अनुशंसित वि...

yahye keita

Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

Desenvolvedor .NET MVC, SQL e ADVPL Protheus

asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui

nhjkmbjkgugyufyufykjkhiu kiuy7yubnbjhggggghutyurrtr lbhrffyyffdfhbjjhgyfgjkgggnjhjvdrtstghjgszzxfvhjjhgjhjjsrdfjpooouiuyui

gdgkiuukgklgkjdgkgdhgghsgjkhfejfghjksdbjidshbkfjlndjhkjdnfkjdghuifnbjklfhdisjnfjdhfihjhejhkdlnfjdnfljkrhfiujnlknduiherionfgioehfienmihsdlkfmdkfukdmkduyfkdntdghifjhrjgbiodghjkfnfgjidhjifnrjkovhdjignjrkhfijrngjrghjrbguierygfiu5ntguiryfiorngurehgoirghurehngjkrhguiorhntiorhg8rntgjkfhguoitngijigmtighujtihgmtigujrijtgsopjdfigkjfiogbujtrikgjfiobvjhkrgjmndiohgkrmngkofjhgkotmngkjlfyotjrngjmdgifuhbdkjfhgdgjkdfhjkdhfjshgjerhyuiotyheruyhudjnmd,nvuidfy984yhoen huifyhry9erhfjhdughrgtnr hyeouifyhr tyry rguy ru grtiorhfgir ng r tr u9r fr f9ryurohfdghdfkjhffdjhrwhiorhrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr hrjlklllllllllllqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee...

...service is down. Logging of requests and responses for easy debugging, monitoring, and auditing. Provide the application in a modular format for future automation enhancements or extensions. The application should run with minimal dependencies and be simple to deploy in a typical Linux environment. Should be able to scale for large datasets or complex automation workflows. Deliverables: A Python-based multithreaded application (or equivalent lightweight language) for automation. Clear documentation on how to install, configure, and use the application. (Optional) Performance optimizations or suggestions for scaling the tool for larger sets of data. Please provide examples of similar automation projects you’ve worked on or any relevant experience with building multithreaded ...

I need a professional to convert a JPG into a PSD for layer extraction purposes. The PSD should have separate layers for text, images, and shapes/graphics. Additional Requirements: - The freelancer should also be able to make some improvements to the design, as I would like the final PSD to be enhanced compared to the original JPG. Ideal Skills: - Proficiency in Adobe Photoshop - Strong graphic design skills - Experience in converting JPGs to layered PSDs - Ability to improve upon existing designs

I'm in search of a telecaller to aid in generating international leads for my IT services company. The leads should span both B2B and B2C sectors. I prefer a commission-based payment structure, as this will ensure that your earnings are directly linked to your performance. KEY RESPONSIBILITIES: - Identify and reach out to potential leads across the globe. - Target both businesses and consumers. - Generate leads that are likely to convert into clients. IDEAL CANDIDATE: - Proven experience in telecalling and lead generation, preferably in the IT services sector. - Strong communication skills. - Ability to work on a commission basis.

I'm looking for a comprehensive financial model template for analyzing potential multifamily investment properties. The model should be suitable for use with an LLC and accommodate optionality for multiple partners, as I plan to go in on properties with several investors. Key Requirements: - Essential forecasting metrics: Include Cash Flow Analysis, Net Operating Income (NOI), Internal Rate of Return (IRR), 3-statements, return metrics, and a structure that can handle distributions to multiple equity investors. (my experience is fairly limited here, so I may want something in here to help better analyze deals that I'm not currently aware of and could use someone's expertise.) - Financial Statements: Income Statement, Balance Sheet, and Cash Flow Statement should be ...

I am in need of a RTL design and Verification expert using SystemVerilog and MATLAB to assist with my project. Key tasks will involve:...have front end ASIC design experience, writing RTL and developing verification environment. Demonstrated proficiency in creating UVM test sequences and sequence items, as well as implementing coverage and assertions, will also be highly favorable. End goal is to build over few months a RISC V based Security IP. Understanding my project requirements, applying your expertise to solve the tasks at hand and delivering high-quality results are key to this project's success. Candidates will be selected based on a interview. Looking for someone interested to learn and develop in a team setting. Please watch this video

I'm seeking a dedicated professional who specializes in Social Media Marketing, specifically on Facebook and Instagram. Key Responsibilities: - Create compelling images/graphics and videos tailored for both platforms. - Enhance brand visibility and engagement through effective content strategies. Ideal Candidate: - Proven experience in social media marketing, particularly on Facebook and Instagram. - Strong skills in graphic design and video production. - Ability to create engaging and shareable content. - Excellent understanding of social media trends and algorithms.

We're seeking a proficient technician to construct a robust VOIP system and a software phone for our company. The main objective is to enhance the reliability of our communication system. Key Responsibilities: - Build a stable VOIP system and software phone compatible with macOS and Linux. - Connect the system to multiple SIP trunk providers and GSM device gateways for line stability. - Assist in finding and connecting to a suitable SIP trunk service provider. - Undertake system maintenance post-construction. - Provide a detailed work plan and quotation for long-term cooperation. Ideal Skills & Experience: - Extensive experience in VOIP system construction. - Proficiency in building software phones compatible with macOS and Linux. - Abi...

I'm looking for a skilled developer experienced in .NET, HTML, and CSS to address few issues in a web application for me. Skills and experience ideal for this job: - Proficiency in .NET, HTML, and CSS. - Experience in developing web applications. - Familiarity with implementing user authentication and payment integration. - Previous work with content management systems. - React Js knowledge is optional, but a plus.

I'm in need of a professional who can assist YCC - Youth Centres of Calgary, a growing charitable youth centre, with updating our existing brand elements and creating new brand elements. This is a comprehensive br...tone-of-voice guidelines for external and internal communications. 3. Visual Identity (Excluding Logo) - Includes defining colour palette, typography, and imagery styles that align with our brand personality. 4. Brand Guidelines - Combines strategy, messaging, and visual identity into a cohesive guide with practical rules for consistent brand usage. 5. Templates (PowerPoint, Email Signatures, Social Media Graphics) You can view our website and social media at the links below for more information.

Job Offer: Full-System Developer for Real Estate Operations Management System Position Overview We are seeking an experienced programmer to develop a comprehensive system tailored to streamline and optimize the operations of our real estate company. This system will integrate monitoring, workflow management, quality control, and data analytics to ensure efficiency and accuracy throughout our processes. Project Requirements Core System Features: Call Monitoring: Track and record activities of callers in real time. Provide screenshot functionalities for supervisors to monitor caller interactions. User Role Management: Assign specific access rights based on user roles (e.g., callers, quality team, data managers). Implement role-based dashboar...

EUWEB 250101 - E-commerce WordPress Developer I'm looking for a seasoned WordPress Developer to assist in enhancing my E-commerce site. This project will consist of 10 Units of Work (UoW), each lasting 4 hours, based on my needs. Need: Expertise in WordPress development specifically for E-commerce; Ability to implement customer review functionalities; Skills in creating a personal blog on WordPress; ...plz, like to work with us (as Wordpress Developer, which we need) ? ...set 10 UoW (10 half/day, a week), when/where like; UoW - Unit of Work, 4 hours/each, on our need; ...choice when work or useful for the work goal; ...at your home, in slippers, without taking a tram or wearing a tie, ...just enough smart neurons available, ...meet with us (sometimes) !!! ...set 10 UoW in e...

EUWEB 250101 - E-commerce WordPress Developer I'm looking for a seasoned WordPress Developer to assist in enhancing my E-commerce site. This project will consist of 10 Units of Work (UoW), each lasting 4 hours, based on my needs. Need: Expertise in WordPress development specifically for E-commerce; Ability to implement customer review functionalities; Skills in creating a personal blog on WordPress; ...plz, like to work with us (as Wordpress Developer, which we need) ? ...set 10 UoW (10 half/day, a week), when/where like; UoW - Unit of Work, 4 hours/each, on our need; ...choice when work or useful for the work goal; ...at your home, in slippers, without taking a tram or wearing a tie, ...just enough smart neurons available, ...meet with us (sometimes) !!! ...set 10 UoW in e...

A plataforma será projetada para integrar o armazenamento descentralizado de dados via blockchain com uma interface amigável, possibilitando que usuários armazenem, gerenciem e acessem seus dados de forma prática. Principais Funcionalidades 1. Gestão de Dados: • Upload e download de arquivos. • Organização em buckets personalizados. • Controle de permissões para múltiplos usuários. 2. Integração via APIs: • Compatibilidade com APIs padrão do mercado, como S3 Compatibility, para facilitar a integração com ferramentas existentes. • Automação de fluxos de dados para empresas que desejam armazenar informações diretamente. 3. Das...

A plataforma será projetada para integrar o armazenamento descentralizado de dados via blockchain com uma interface amigável, possibilitando que usuários armazenem, gerenciem e acessem seus dados de forma prática. Principais Funcionalidades 1. Gestão de Dados: • Upload e download de arquivos. • Organização em buckets personalizados. • Controle de permissões para múltiplos usuários. 2. Integração via APIs: • Compatibilidade com APIs padrão do mercado, como S3 Compatibility, para facilitar a integração com ferramentas existentes. • Automação de fluxos de dados para empresas que desejam armazenar informações diretamente. 3. Das...

I'm looking for a talented caricature artist who can create a realistic style caricature of two people. This will be a gift for someone special, so the artwork needs to be thoughtful and well-executed. I basically want a drawing of my friend and her recently deceased mom sitting in the front seat of a VW bus smiling. Perhaps a nice sunset in the background but this is pretty basic. Ideal Skills and Experience: - Proficiency in creating realistic caricatures - Strong artistic and creative skills - Experience in creating personalized artwork - Ability to capture likeness and personality - Good communication skills for understanding client’s requirements

I'm seeking an experienced iOS developer to create an iPad app that connects to an API for managing both user check-in and waiver signing. Key Features: - User Authentication: Users should authenticate themselves via a unique QR code, with their names or reservation number - Check-In Process: The app should manage user check-in seamlessly, if there is a payment pending they have to go on the counter. - Waiver Signing: Post check-in, users should be redirected to the waiver signing page. - Confirmation Messages: A confirmation message should be displayed after successful check-in. Ideal Skills: - iOS Development: Proven experience in developing iPad applications. - API Integration: Expertise in connecting apps to APIs. - QR Code Scanning: Previous work implementing unique use...

...materials for an exciting sales campaign we are running for our Mo-Dad 2 Poly System. This is an excellent opportunity to showcase your creativity while helping us communicate the benefits of becoming a distributor for our product. I have enclosed icons that I would like to use in the promotional material. And also other promotional material that we have already made along with pictures of the tanks themselves and our logo. Scope of Work The promotional material will include: 1. Handout Flyer: • Design a visually appealing flyer outlining the process for potential customers to become distributors. • Include the following steps: • Approve with a credit check and background check. • Receive an eight-system load directly from the manufactur...

I need travel based video editor for making professional videos, energetic video, making high end graphics, extra ordinary video editor needed with out of the box thinking and work. Check the work we expect:

Would like to work with a Fashion Designer to fine tune the design of a Cargo Pant and adjust the measurements, where necessary, throughout the entire size scale in order to get a North American/USA Relaxed Fit in the Hip/Seat with Straight Cut Legs. We will provide a picture of the cargo pant design along with the basic measurement Guidelines. What we expect: 1. You will adjust the measurements to conform to the fit we require. 2. Consultation on the measurements to ensure we get the desired fit. 3. Diagram of pant with measurements for the entire size scale. 4. Consultation on Fabric Specification to ensure the pant stands up to work abuse, excessive washing etc... with minimal fading etc…

Project Description: I am seeking a skilled professional in cybersecurity and mobile app development to create a highly secure communication system designed to protect all communications from surveillance or interception. Key Features of the Project: 1. Secure Device: Customization of a smartphone to operate only via Wi-Fi. Disabling unnecessary features such as GPS, camera, microphone, and cellular modem. Customizing the operating system (e.g., GrapheneOS or CalyxOS) to prevent unauthorized modifications. 2. Custom Communication App: A messaging app similar to WhatsApp featuring:  Encrypted text messages.  Multimedia file sharing.  Secure audio calls. Peer-to-peer communication only (no intermediate servers). Implementation of advanced end-to-end encryption. 3. Anonymou...

I'm searching for a skilled Laravel developer to finalize our Legal Management System. This is an opportunity to work on a unique project with substantial potential. Key Responsibilities: - Completing frontend development: The UI needs to be intuitive and user-friendly for legal professionals. - Enhancing backend functionalities: The system should be robust, secure, and able to handle a high volume of data and transactions. - Database integration: We need a reliable and efficient database setup that can manage case files, documents, billing information, etc. Ideal Skills and Experience: - Extensive experience with Laravel framework - Previous work on developing or improving a legal management system - Strong skills in frontend development, particularly with crea...

Hi Sameen, Key requirements: - Experience with Shopify - Ability to create a user-friendly and attractive one-page site - Knowledge of e-commerce best practices - Use our branding pack complete with fonts, graphics, colours and images this is to complete the website in a mix of styles : or using spotify Everthing as discussed in previous message

I'm looking for a talented programmer with experience in blockchain technology who can create a meme coin for me on the Solana network. Key Aspects of the Project: - Creation of a basic token with a fixed supply. - Integration of pre-existing logo into the coin. Ideal Skills and Experience: - Proficient in blockchain programming, particularly on Solana. - Experience in token development. - Ability to integrate custom assets into the project.

I'm seeking a proactive professional for outbound prospecting on behalf of my marketing company. The task involves using a designated email address to connect with specific brands and target audiences. Key Responsibilities: - Prospecting CPG Brands, Retail, Travel, Finance, and Consumer Facing companies with a net revenue of over 5M. - Targeting key decision-makers, including Brand Managers, Directors, Marketing Managers, Promotions Managers, and Assistant Brand Managers. - Setting up meetings using Microsoft products. Skills and Experience: - Prior experience in outbound marketing or prospecting. - Proficiency with Microsoft products. - Access to a current list of relevant brands. - Excellent communication skills, with the ability to convincingly represent our company. - ...

I'm looking for a skil...sense of clean and minimal editing, with a focus on maintaining the integrity of the content while delivering a polished final product. Key Responsibilities: - Edit interview footage into engaging, clean, and minimalist videos - Incorporate specific visual elements as needed, including text overlays, transitions, and animated graphics Ideal Skills: - Proficiency in video editing software - Experience with editing documentary-style footage - Creative with animated graphics and transitions - Able to understand and deliver a 'clean and minimal' editing style I value quality over quantity, and I'm looking for someone who can help me deliver top-notch content to my audience. Check out my current reels on IG: elevate_by_daria ()

I'm looking for an Excel developer to create an inventory management system. While specifics on the functions of the system haven't been detailed yet, the system will need to track stock levels and generate reports. As such, the ideal freelancer for this project should have prior experience in developing similar systems on Excel. Skills and experience required: - Advanced knowledge of Excel - Prior experience in developing inventory management systems - Ability to generate and interpret detailed reports - Excellent understanding of tracking stock levels

I'm seeking a developer to create an external system for managing a unidirectional synchronization between our main system (an AI bot simulating a digital assistant) and various calendars (Google Calendar, Apple Calendar, and CalDAV). Key Responsibilities: - Receive data from our main system via an API. - Synchronize this data with linked calendars. - Implement a resynchronization feature accessible from both the API and a web interface. Ideal Candidate: - Proficient in API integration - Experienced with Google Calendar, Apple Calendar, and CalDAV - Capable of synchronizing events, reminders, and tasks. Please note, the system's primary role will be to sync events, reminders, and tasks from our main system to the linked calendars. Spanish-speakin...

I'm seeking a skilled graphic designer for a detailed edit on my logo. The modifications needed involve color, graphics, and text. Key Requirements: - Color Adjustments: Help me enhance the overall aesthetic of the logo with some color tweaks. - Graphic Modifications: The logo will need some graphic modifications to better represent the brand. Ideal Skills: - Proficient in Adobe Illustrator or similar design software. - Strong understanding of color theory and branding. - Excellent graphic design skills. - Good understanding of typography for potential future text changes.

I'm looking for a skilled video editor to help me polish up my podcast videos. The final product will be over 30 minutes long and will require: - Video editing: Cutting down the footage to keep the pacing tight and engaging. - Audio editing: Ensuring the sound is crisp and clear, removing any unwanted noise. - Adding graphics or effects: Incorporating visuals to enhance the viewing experience. - And other skills necessary to make the video engaging You should have experience with long-form video content and a good understanding of how to keep an audience engaged. Please provide examples of your previous work. And do specify your charges.

We have few job positions opened in Houston, Texas. If you are based in Houston please bid and we can discuss. Jobs include product researcher, customer support rep, sales manager etc

...appealing to the target demographic of young, enthusiastic learners. Key Tasks: - Redesign the site with a focus on user experience and a fun, vibrant aesthetic - Implement features such as online booking for lessons, student testimonials and reviews, and guitar learning resources and tutorials - Ensure the site is high-performing and able to handle traffic from potential students (images and graphics to be made by your side if needed only logo will be provided) - a copyright page page also needed to be created. - terms and condition page - privacy policy page - refund and cancel policy Ideal Skills: - Expertise in web design and development - Experience with user-friendly, fun and vibrant design styles - Ability to implement interactive features such as online booking and revie...

I'm in need of a professional graphic designer who can breathe new life into my classic-style logo. The update should incorporate some added graphics and my business name. Key Requirements: - Transform the logo to include: - Icons or symbols - Lines or shapes - Textures or patterns - Use of Bold and Vibrant colors Ideal Skills: - Proficient in graphic design software - Strong understanding of classic design principles - Ability to blend modern elements into a classic style - Excellent color theory knowledge - Creative and innovative thinking

I'm looking for experienced blockchain developers to help develop a large-scale DeFi platform on the Ethereum blockchain. The ideal candidates should be well-versed in DeFi and understand its intricacies. Key requirements: - Proficient in Ethereum blockchain - Experienced in DeFi development - Capable of creating a large-scale platform Please note, I need to hire as soon as possible.

Project Overview I am looking for a developer (or development team) to create a responsive web-based system that enables real estate agents to design professional graphics for property listings on social media platforms. The system should be user-friendly, secure, and include features such as user profile management, direct social media sharing, and personalization options. Technical Requirements Full Responsiveness: Support for desktops, tablets, and smartphones. A user interface that adapts seamlessly to both small and large screens. User Profile Management: Allow users to upload their photo, logo, and phone number in the profile settings. Restrict users to designing graphics only for their own profile. Dynamic Template Design: Pre-designed template...

I'm looking for a professional skilled in graphic design to redo a CDR image for me using CANVA. The tasks will involve updating the text content and revamping the graphics. The layout doesn't need to be altered, just the elements within it. Key Requirements: - Proficiency in CANVA - Previous experience with CDR images - Strong graphic design skills - Good command over English for text content updates

I'm in need of a skilled video editor specializing in both 2D and 3D animation. The course videos will primarily consist of lectures and presentations, and should be tailored with educational and explanatory graphics. Ideal Skills: - Proficiency in video editing software - Strong background in 2D and 3D animation - Ability to create educational and explanatory graphics - Experience in editing lecture and presentation videos - Creative mindset to make course content engaging

Freelance Post Designer Wanted for Travel Company We a...similar creative work. Proficiency in design tools such as Adobe Photoshop, Illustrator, Canva, or other relevant software. Ability to work within deadlines and adapt to feedback. A creative eye for detail and the ability to produce content that resonates with a diverse audience. Preferred Skills: Knowledge of social media design standards and trends. Experience in video editing or creating motion graphics is a plus. What We Offer: Flexible work arrangements with remote collaboration. A chance to showcase your work to a broad audience of travel enthusiasts. Opportunities for long-term collaboration on future projects. If you’re passionate about design and have a flair for storytelling through visuals, we’d love...

...at driving increased phone calls, foot traffic, and sales to our hand car wash and detail shop, Faevaa Detail World, located in Houston, Texas. Additionally, the expert will set up a tailored CRM system designed to collect and manage customer data from the leads generated through these ad campaigns. The CRM should be user-friendly and optimized for the unique needs of a hand car wash and detail shop, while integrating seamlessly with tools such as Mailchimp and Zapier. Scope of Work: Ad Creation & Setup: Develop and design compelling Facebook and Instagram ad creatives, including static graphics and video ads. Create targeted story ads for Facebook and Instagram to maximize engagement and conversions. Ensure all ads are visually appealing and tailored to our brand a...

I have a simple logo that needs to be vectorized and cleaned. The current format I have is PNG. I need a ESP, PNG, PSD file of it. Ideal Skills and Experience: - Proficient in Adobe Illustrator or similar vector graphics software - Experience with logo design and vectorization - Attention to detail for cleaning up the logo