Filtër

Kërkimet e mia të fundit
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftёsitё
Gjuhët
    Shteti i punës
    2,000 freelancers vb bangalore u gjetën punë
    Break fix WO-015177535
    Ka përfunduar left

    Name Keshav V Mallathalli, 560056 bangalore

    €8 / hr Average bid
    Lokale
    €8 / hr Oferta mesatare
    1 ofertat
    qefqreqweqawdafsc
    Ka përfunduar left

    asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

    €190 Average bid
    €190 Oferta mesatare
    1 ofertat
    yveguwvcjnjnecbkhb
    Ka përfunduar left

    ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

    €108 Average bid
    €108 Oferta mesatare
    1 ofertat
    Russian Recording Project -- 89600
    6 ditë left
    Të verifikuara

    Russian Recording Project We need Freelancers for long term Project. We have a project, that needs Native Russian speakers, we will give you the text, and you need to record 20 sentences. Every sentences is 2 word, you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is $1.5 dollar for 20 sentences record. Every sentences is 2 word If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the project. Thanks :

    €3 / hr Average bid
    €3 / hr Oferta mesatare
    9 ofertat
    Cross Platform Mobil Uygulama
    6 ditë left
    Të verifikuara

    Bir hap eğitim uygulaması düşünüyorum. Ücretli p2p video görüşmeleri ve ücretli yorumların yapılacağı bir mentör-öğrenci platformu olacak. Belirli bir sektör için olacak. Şu anda logo domain vb. kimlikler hazır. Yapısal olarak detayları ayrıca toplantıda görüşebiliriz. Bu uygulama sonrası sürekli bakimi ve geliştirme olacaktır o yüzden uzun süreli bir çalışma ön görüyoruz. Note for foreign freelancers; Fluent Turkish language is a must here. Thank you.

    €1273 Average bid
    €1273 Oferta mesatare
    14 ofertat

    I'm looking for an expert who can enhance my Wikipedia page. The enhancements should cover: - Content details: Adding new sections, updating existing information, and providing historical context. - Citations and references: Incorporating citations from academic journals and news articles. Visual layout and images also need to be upgraded. Freelancers bidding for this job should have a strong background in content creation and Wikipedia's editing standards. Experience with sourcing and integrating references from academic journals and reputable news articles is crucial. A knack for visual design and layout will also be beneficial.

    €849 Average bid
    €849 Oferta mesatare
    34 ofertat

    I'm looking for a professional with experience in chatbot development to convert the messaging system of my Smartstore (NopCommerce) into a fully functioning chatbot. Key Requirements: - Knowledge and experience in chatbot development - Familiarity with Smartstore (NopCommerce) - Ability to create a customer support, sales and lead ...create a customer support, sales and lead generation, and user engagement chatbot - Flexibility to work with any chatbot development framework The ideal freelancer would be able to: - Understand and implement various chatbot functionalities - Suggest and utilize an appropriate chatbot development framework - Achieve a high level of integration with Smartstore's existing features Bids from freelancers with a portfolio of similar projects ...

    €2185 Average bid
    €2185 Oferta mesatare
    87 ofertat
    Russian Recording Project -- 34980
    6 ditë left
    Të verifikuara

    Russian Recording Project We need Freelancers for long term Project. We have a project, that needs Native Russian speakers, we will give you the text, and you need to record 20 sentences. Every sentences is 2 word, you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is $1.5 dollar for 20 sentences record. Every sentences is 2 word If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the project. Thanks :

    €7 / hr Average bid
    €7 / hr Oferta mesatare
    6 ofertat

    Portugal Portuguese Recording Project We need Freelancers for long term Project. We have a project, that needs Native Portugal speakers, we will give you the text, and you need to record 1000 Short sentences. you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is $20 dollar for 1000 sentences record. After you finished recording and then we will pay u 50%. after your checking done and then we will pay u remaining 50%. it will take time to check 5-7 days. If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the project. ...

    €8 / hr Average bid
    €8 / hr Oferta mesatare
    1 ofertat

    Hello! I'm looking for a confident, articulate female freelancer aged between 17 and 25 to record her short school introduction video on behalf of students. The video should be 20 to 40 seconds long and filmed by my script in which she will give introduction. This is purely an academic project and will not be shared on social media. Requirements: - Good English accent - Confidence in recording videos - Aged between 17 and 25 - Female - Able to wear formal attire for the video In the video, you should adopt a confident posture and deliver the script with proper impressions, not just reading the lines. Budget: $5 How to Apply: Please send me a voice note of you reading the following script in your best English accent: "My name is Amelia and I'm taking this course because ...

    €5 / hr Average bid
    €5 / hr Oferta mesatare
    4 ofertat

    Needs to hire 2 Freelancers We are seeking a talented developer to create an augmented reality (AR) application. CLIENT: The End User is the Aged/Disabled Person, but the Target Adopter is likely to be their child and/or carer

    €656 Average bid
    €656 Oferta mesatare
    42 ofertat

    I'm looking for a legal professional to help draft some important documents for student use. These documents include a Power of Attorney and a Quit Claim Deed. Ideal freelancers for this project should have solid experience in legal document drafting. Understanding of property law and power of attorney specifics is crucial. Quality, attention to detail and adherence to legal standards are key.

    €164 Average bid
    €164 Oferta mesatare
    28 ofertat

    More details: Is this project for business or personal use? Personal What information should successful freelancers include in their application? Detailed project proposals How soon do you need your project completed? ASAP

    €27 Average bid
    €27 Oferta mesatare
    22 ofertat
    Spanish writer
    6 ditë left

    Hello we need good new freelancers for this job post If you're interested in this job post kindly contact the project director via WhatsApp number below ‪+1 (825) 573‑6810‬

    €751 Average bid
    €751 Oferta mesatare
    58 ofertat

    ...Creators. Qualifications: Proven experience in recruiting, preferably in influencer marketing or UGC. Strong communication and negotiation skills. Familiarity with the social media landscape in Germany and the UK. Fluent in English; proficient in using AI (ChatGPT) for well written communications in varying languages. Qualifications: Proven experience in sourcing creators, influencers, or freelancers, preferably in the UGC space. Exceptional skills in advanced Google search queries (e.g., site:, exact match, Boolean operators). Familiarity with European markets and the UGC/influencer industry. Strong organizational skills and attention to detail. Excellent written and verbal communication skills in English (additional European languages are a plus). Experience with tools like C...

    €5 / hr Average bid
    €5 / hr Oferta mesatare
    18 ofertat

    I'm seeking a US-based freelancer to review our website content. The focus will be on grammar and spelling, as well as clarity and readability. Key Responsibilities: - Thoroughly check website content for grammatical errors and spelling mistakes. - Evaluate the clarity and readability of the content. Please note, the freelancer needs to be based in the United States. Interested freelancers are welcome to apply.

    €94 Average bid
    €94 Oferta mesatare
    16 ofertat

    *** OVERVIEW *** - Ten US dollars per hour. - One hour per day (or per night). - You will help...section entirely. Of course you can apply for this job the “normal way.” However, if Freelancer.com prevents you from bidding on this project or if you want to avoid “spending” one of your Freelancer bids you can apply "passively” for this project by pasting.... MicroPython_ESP32_11_September_2019 into your Freelancer profile. If this job posting is active, I intend to search for freelancers with the search text: MicroPython_ESP32_11_September_2019 in their Freelancer profile every few days. If I were to find your profile and if your profile were to indicate that you live in one of the countries indicated above, then I would...

    €10 / hr Average bid
    €10 / hr Oferta mesatare
    6 ofertat

    Existing dating point, just like other app in which we swipe on the picture , left or right to match. It has some glitches because of which it's not displaying the pictures. Need to fix that. Made in laravel. Please bid only if you are experienced in laravel and think you can. Do it in the s...like other app in which we swipe on the picture , left or right to match. It has some glitches because of which it's not displaying the pictures. Need to fix that. Made in laravel. Please bid only if you are experienced in laravel and think you can. Do it in the specified budget. Regards More details: Is this project for business or personal use? Personal What information should successful freelancers include in their application? Experience How soon do you need your project compl...

    €382 Average bid
    €382 Oferta mesatare
    62 ofertat

    *** OVERVIEW *** - Ten US dollars per hour. - One hour per day (or per night). - You will help...section entirely. Of course you can apply for this job the “normal way.” However, if Freelancer.com prevents you from bidding on this project or if you want to avoid “spending” one of your Freelancer bids you can apply "passively” for this project by pasting.... MicroPython_ESP32_11_September_2019 into your Freelancer profile. If this job posting is active, I intend to search for freelancers with the search text: MicroPython_ESP32_11_September_2019 in their Freelancer profile every few days. If I were to find your profile and if your profile were to indicate that you live in one of the countries indicated above, then I would...

    €10 / hr Average bid
    €10 / hr Oferta mesatare
    4 ofertat

    I'm seeking skilled freelancers with expertise in Google Big Query and Google Sheets to assist with crucial tasks. Data Structuring and Query Optimization - You will work with multiple data sources flowing into our Google Big Query Data Warehouse on GCP, primarily external APIs and third-party analytics tools. - Your role will involve writing efficient and optimized SQL queries to structure and process the data. Report Automation - You'll be responsible for automating the generation of daily sales reports directly on Google Sheets. - It's vital that these reports ensure real-time updates and seamless integration with our Big Query data. Skills Required: - Proficiency in Google Big Query and SQL is essential. - Hands-on experience with Google Sheets and its automati...

    €119 Average bid
    €119 Oferta mesatare
    2 ofertat

    I need someone to make minor tweeks to my Android sorce code for my dating app and submit it to the Play Store. The app is fully developed but I need to make minor changes More details: Is this project for business or personal use? Personal What information should successful freelancers include in their application? Experience How soon do you need your project completed? ASAP

    €163 Average bid
    €163 Oferta mesatare
    18 ofertat
    Malay Recording Project -- 75361
    6 ditë left
    Të verifikuara

    Malay Recording Project We have a project, that needs Native Malay speakers, we will give you the text, and you need to record 180 Short sentences. you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise....give you the text, and you need to record 180 Short sentences. you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is $4 dollar for 180 sentences record. If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of th...

    €4 / hr Average bid
    €4 / hr Oferta mesatare
    4 ofertat

    I'm in need of a professional graphic designer who can create a unique and impactful logo for my company, Go Desi. We specialize in manufacturing curd (dahi) in pots made from pure buffalo milk. Key Requirements: - The logo should be...not been specifically defined yet. You will have the creative freedom to choose whether to go with a modern and minimalist approach, a traditional and ornate style, or a playful and fun design. Skills and Experience Needed: - Proven graphic design experience - Strong portfolio of logo designs - Proficiency in design software - Excellent understanding of color theory and design principles Freelancers with experience in the food industry or with creating logos featuring animals will be given preference. Final files: PNG, JPG, PDF Source files:...

    €49 Average bid
    €49 Oferta mesatare
    28 ofertat
    Trophy icon Youth Sports Program Logo Design
    2 ditë left

    Logo Design Brief for Straight Path Athletics and Maryland Lightening Project Overview: We are seeking talented freelancers to design two unique logos: 1. Entity Logo: Straight Path Athletics 2. Team Logo: Maryland Lightening Our organization is a youth sports program based in Maryland, rooted in Islamic principles and core values. We aim to inspire kids through athletics, starting with basketball and eventually expanding into flag football, baseball, and other sports. The logos will be used for branding, including our website, social media, uniforms, and other promotional materials. Entity Logo: Straight Path Athletics • Purpose: Represents the overall organization, encompassing all teams and sports under our program. • Design Style: Modern, sleek, and professiona...

    €48 Average bid
    I garantuar
    €48
    275 kandidaturat

    ...in vanilla JS if possible) Other approaches that achieve the same behavior reliably across both iOS and Android. Deliverables: A working demonstration link hosted by you that I can test in an Instagram bio to ensure it opens in the native browser without prompts. Documentation or explanation of the solution so it can be implemented on my webpage. Important Notes: Test Link is Mandatory: Only freelancers who provide a working test link will be considered for this project. I am looking for someone with expertise in web technologies and a proven track record of solving similar challenges. Please do not bid if you are unsure how to achieve this. Budget: I am open to discussing the budget depending on the complexity and reliability of the solution. If you have the skills to create t...

    €59 Average bid
    €59 Oferta mesatare
    22 ofertat

    I'm looking for a professional who can help increase my brand's visibility on Facebook, Instagram, and Twitter through strategic text posts. Key Requirements: - Create and manage engaging text-based content across all three platforms. - Develop and implement a strategy focused...Facebook, Instagram, and Twitter through strategic text posts. Key Requirements: - Create and manage engaging text-based content across all three platforms. - Develop and implement a strategy focused on enhancing brand awareness. - Monitor and report on social media metrics to assess the effectiveness of the strategy. Ideal Skills: - Social Media Marketing - Content Creation - Brand Development Freelancers with a proven track record in improving brand visibility on social media platforms are ...

    €17 / hr Average bid
    €17 / hr Oferta mesatare
    54 ofertat

    ...Employer Registration Page Create Task Page (Freelancer) Post Project Page (Employer) Freelancer Profile Page Employer Profile Page Task Search/Listing Page (for both Freelancers and Employers) Freelancer Search Page (used by Employers to find Freelancers) Show State Field Filter: Add a State field filter on the following pages: Freelancer Registration Page Employer Registration Page Create Task Page (Freelancer) Post Project Page (Employer) Freelancer Profile Page Employer Profile Page Task Search/Listing Page (for both Freelancers and Employers) Freelancer Search Page (used by Employers to find Freelancers) Connect State with City (Dependent Dropdown): Ensure that the City dropdown only shows cities from the selected State on the following...

    €110 Average bid
    €110 Oferta mesatare
    20 ofertat

    ...start date. Budget: I am looking for cost-effective solutions without compromising on quality. Please provide your quote along with the proposal. Selection Criteria: Proven track record with e-commerce and blogging sites. Competitive pricing. Portfolio of visually appealing and functionally robust websites. Excellent communication skills and timely updates. Proposal Requirements: Interested freelancers should submit a proposal that includes: A brief introduction and understanding of the project. Outline of the proposed solution and technologies to be used. A breakdown of phases and timelines. Total cost estimate. Examples of similar websites developed in the past. Conclusion: This website will be pivotal in scaling KHROCHET to a wider audience while providing a seamless and e...

    €755 Average bid
    €755 Oferta mesatare
    225 ofertat

    Using these 'Sculpt your sexy' facebook ads, select one of these bikini shots and recreate the ad. Please ensure you recreate the ad by: 1. Adding the same filters, colour saturation and iconic angelic glow to the model 2. Copy the 'Sculpt Your Sexy' brand font and size I'm looking for a designer tha...ad. Please ensure you recreate the ad by: 1. Adding the same filters, colour saturation and iconic angelic glow to the model 2. Copy the 'Sculpt Your Sexy' brand font and size I'm looking for a designer that can create this style of content for me on a monthly basis. More details: Is this project for business or personal use? For an existing business What information should successful freelancers include in their application? Experience...

    €9 Average bid
    I garantuar
    €9
    9 kandidaturat

    I am looking for a full stack developer to help finish and clean up my SaaS project: Func...project: Functionality bug fixes. The tech stack includes PHP, Laravel, and Codeigniter. Ideal Candidate: - Extensive experience in PHP, Laravel, Codeigniter & Payment Processing APIs. - Proven track record in full stack development and SaaS project completion. - Strong troubleshooting skills to identify and resolve bugs efficiently. U.S. developers only please. I'm not offshoring this work. Freelancers only. No companies will be considered. Must provide at least two contactable references with whom I can speak with regarding your work ethic, your work quality and your references can verify your experience in the two mentioned languages. No client/employer references then no con...

    €34 / hr Average bid
    €34 / hr Oferta mesatare
    112 ofertat

    Portugal Portuguese Recording Project We need Freelancers for long term Project. We have a project, that needs Native Portugal speakers, we will give you the text, and you need to record 1000 Short sentences. you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is $20 dollar for 1000 sentences record. After you finished recording and then we will pay u 50%. after your checking done and then we will pay u remaining 50%. it will take time to check 5-7 days. If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the project. ...

    €8 / hr Average bid
    €8 / hr Oferta mesatare
    17 ofertat
    Russian Recording Project -- 89362
    6 ditë left
    Të verifikuara

    Russian Recording Project We need Freelancers for long term Project. We have a project, that needs Native Russian speakers, we will give you the text, and you need to record 20 sentences. Every sentences is 2 word, you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is $1.5 dollar for 20 sentences record. Every sentences is 2 word If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the project. Thanks :

    €3 / hr Average bid
    €3 / hr Oferta mesatare
    8 ofertat

    We are seeking reliable and skilled freelancers to post high-quality, relevant answers and comments on Quora. This is a long-term opportunity, and we need a minimum of 10-15 freelancers to help us meet our goals. What We Need: Total Answers Needed: 1500+ (Each answer should be handmade, not AI-generated or copy-pasted). Quora Account Requirements: You must use different Quora accounts (15+ accounts, each minimum 1 year old). Each account needs to post 100+ answers. Accounts must be active and ready to post answers. Provide us with the email and password for each account you use. Quality Standards: Answers must be relevant to the niche we promote. You must use the name of our website in your answer and bold it for better visibility. Answers should be detailed, informative, ...

    €109 Average bid
    €109 Oferta mesatare
    43 ofertat

    Description: ClipOn Agency, an agency specializing in creating and editing short videos for social media, is looking for experienced video editing freelancers who can deliver fast, high-quality and reliable work. What we are looking for: • Experience in editing short videos for platforms such as Instagram, TikTok and YouTube Shorts. • Ability to create compelling videos with: • Dynamic and creative subtitles. • Fluid and modern transitions. • Attention-grabbing music and effects. • Short-term delivery (1-3 days per video). • Attention to detail and commitment to feedback and reviews. • Portfolio with examples of short videos already edited. What we offer: • Recurring and consistent work (average of 10-20 videos per mon...

    €21 Average bid
    €21 Oferta mesatare
    36 ofertat

    I need a motion to compel further responses due to incomplete discovery responses from the opposing party. This has led to a series of obstacles that are affecting the progress of the case. Key issues include: - Evasive Answers: The opposin...opposing party has been providing objections without merit and partial information. - Document Production: I am specifically seeking financial records and contractual agreements that have not been produced. Ideal skills for this job include: - Knowledge of California discovery process - Experience in drafting motions to compel - Strong understanding of financial and contractual documentation Freelancers with legal background or experience in litigation will be highly considered. The goal is to obtain the necessary information to move the cas...

    €21 / hr Average bid
    €21 / hr Oferta mesatare
    33 ofertat

    ...Creators. Qualifications: Proven experience in recruiting, preferably in influencer marketing or UGC. Strong communication and negotiation skills. Familiarity with the social media landscape in Germany and the UK. Fluent in English; proficient in using AI (ChatGPT) for well written communications in varying languages. Qualifications: Proven experience in sourcing creators, influencers, or freelancers, preferably in the UGC space. Exceptional skills in advanced Google search queries (e.g., site:, exact match, Boolean operators). Familiarity with European markets and the UGC/influencer industry. Strong organizational skills and attention to detail. Excellent written and verbal communication skills in English (additional European languages are a plus). Experience with tools like C...

    €3 / hr Average bid
    €3 / hr Oferta mesatare
    9 ofertat

    Portugal Portuguese Recording Project We need Freelancers for long term Project. We have a project, that needs Native Portugal speakers, we will give you the text, and you need to record 1000 Short sentences. you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is $20 dollar for 1000 sentences record. After you finished recording and then we will pay u 50%. after your checking done and then we will pay u remaining 50%. it will take time to check 5-7 days. If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the project. ...

    €8 / hr Average bid
    €8 / hr Oferta mesatare
    16 ofertat
    Russian Recording Project -- 62608
    6 ditë left
    Të verifikuara

    Russian Recording Project We need Freelancers for long term Project. We have a project, that needs Native Russian speakers, we will give you the text, and you need to record 20 sentences. Every sentences is 2 word, you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is $1.5 dollar for 20 sentences record. Every sentences is 2 word If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the project. Thanks :

    €3 / hr Average bid
    €3 / hr Oferta mesatare
    14 ofertat

    ...digital marketing efforts. Ideal Candidate: - Proven experience in digital marketing, preferably within the food industry. - Exceptional knowledge of social media marketing, SEO, and email campaigns. - Capable of understanding and implementing marketing strategies aimed at boosting brand recognition. - Location Tamil Nadu, South India, is preferred due to business location. Compensation: - Freelancers: Tasks will be allocated based on your capabilities and performance. - Potential Partners: Compensation will be on a share basis, contingent upon your demonstrated capability and contribution to the business. Your application is welcome regardless of your location, however, preference will be given to candidates based in Southern India. Further queries can be asked in the mess...

    €88 Average bid
    €88 Oferta mesatare
    17 ofertat

    Russian Recording Project We need Freelancers for long term Project. We have a project, that needs Native Russian speakers, we will give you the text, and you need to record 66 short sentences. you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is $3 dollar for 66 sentences record. If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the project. Thanks :

    €31 / hr Average bid
    €31 / hr Oferta mesatare
    22 ofertat

    ...Creators. Qualifications: Proven experience in recruiting, preferably in influencer marketing or UGC. Strong communication and negotiation skills. Familiarity with the social media landscape in Germany and the UK. Fluent in English; proficient in using AI (ChatGPT) for well written communications in varying languages. Qualifications: Proven experience in sourcing creators, influencers, or freelancers, preferably in the UGC space. Exceptional skills in advanced Google search queries (e.g., site:, exact match, Boolean operators). Familiarity with European markets and the UGC/influencer industry. Strong organizational skills and attention to detail. Excellent written and verbal communication skills in English (additional European languages are a plus). Experience with tools like C...

    €2 / hr Average bid
    €2 / hr Oferta mesatare
    10 ofertat

    ... - - - - Use these websites and its booking form as an example do not send me random websites that you have copied and pasted from WordPress or made and its similar to other random websites and they all have the same booking forms even with freelancers from Fiverr Upwork and Freelancer. Ideal candidates should have experience in creating simple and modern booking forms, as well as good pricing for low-budget projects. Please, no overly expensive proposals....

    €218 Average bid
    €218 Oferta mesatare
    145 ofertat

    I'm looking for a user-friendly Android app that I can use to generate commercial offers while on-site with clients. Currently, I use an Excel file at home, but I need something more convenient for mobile use. Key Features: - Price Calculation: The app should be capable of calculating prices based on input parameters. Integr...The app needs to integrate with Excel, as I currently use this for my pricing and offers. Ideal Skills: - Experience in low-code app development, particularly for Android. - Proficiency in integrating apps with Excel. - Understanding of price calculation algorithms. The goal is to make the process seamless and efficient, ultimately improving the client interaction experience. Proposals from freelancers with a clear understanding of this project will ...

    €502 Average bid
    €502 Oferta mesatare
    73 ofertat

    I'm seeking a seasoned Business Development Executive to drive our IT company's software development and consulting services on a global scale. This role operates on a commission basis per project. Key Responsibilities: -...international clients in need of IT services - Promote our software development and IT consulting offerings - Negotiate project contracts and terms Ideal Skills and Experience: - Prior experience in IT industry business development is a must - Excellent communication and negotiation skills - Proven track record of successful project acquisition - Ability to identify and target prospective clients Freelancers with a network of international IT service clients will be given preference. This role offers immense earning potential for proactive and result...

    €277 Average bid
    €277 Oferta mesatare
    2 ofertat

    I'm in urgent need of a professional adept in data entry and article writing. The task involves crafting product descriptions and technical articles on software development, with a particular focus on programming languages. Key Responsibilities: - Write compelling product descriptions that capture the essence of our offe...product descriptions that capture the essence of our offerings. - Create informative and engaging technical articles centered on programming languages within the software development landscape. Ideal Skills: - Strong writing and data entry skills. - Knowledge and understanding of software development and programming languages. - Experience in writing product descriptions and technical articles. Freelancers who can deliver quality work under tight deadlines...

    €14 / hr Average bid
    €14 / hr Oferta mesatare
    56 ofertat

    Looking for a Freelancer to Run Ads for My E-Book (Revenue-Share Model) Description: Hello Freelancers, I am looking for an experienced and result-oriented digital marketer or advertiser to help me promote my e-book: "Astrology for Career and Success". This book has immense value for individuals seeking guidance in their professional lives, and I am confident it can gain great traction with the right marketing efforts. What I Am Offering: This is a performance-based project. You will run ads (on platforms like Facebook, Google, or Instagram) to promote the e-book. For every sale you generate, you will receive 15% of the profit. No upfront payment—your earnings will be directly linked to your performance. What I Expect From You: Proven experience in running ad camp...

    €183 Average bid
    €183 Oferta mesatare
    19 ofertat

    Description: Our Company is dedicated to inspiring and motivating children through creative and uplifting art. We are seeking talented freelancers to help us bring our vision to life and make a positive impact on young minds. Most of the artwork is simple for kids, we just need creative minds to make adjustments and prepare the art for various uses, we have ideas and know-how how art need to look. What We Need: We are looking for skilled freelancers in the following areas: • Illustrators: To design engaging and motivational artwork for children. • Graphic Designers: To help format and enhance our designs for various platforms. What We Offer: • Simple and straightforward tasks with clear guidelines. • Flexible working hours and remote opportunities. &...

    €15 / hr Average bid
    €15 / hr Oferta mesatare
    33 ofertat

    I'm on the lookout for a free launcher in Bangalore for the launch of my e-commerce website. The site will exclusively sell digital products, and the primary goal is to establish a strong online presence in the competitive e-commerce landscape. Ideal Skills and Experience: - Previous experience with website launch events - Strong understanding and experience in e-commerce - Experience in launching digital products - Excellent networking abilities in Bangalore - Marketing and promotional skills

    €101 Average bid
    €101 Oferta mesatare
    13 ofertat
    Russian Recording Project -- 9989
    5 ditë left
    Të verifikuara

    Russian Recording Project We need Freelancers for long term Project. We have a project, that needs Native Russian speakers, we will give you the text, and you need to record 20 sentences. Every sentences is 2 word, you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without echo. 2. Each person is $1.5 dollar for 20 sentences record. Every sentences is 2 word If you are interested please let me know sure.I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the project. Thanks :

    €2 / hr Average bid
    €2 / hr Oferta mesatare
    11 ofertat