Electronics based vb net projects punët
Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc
asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr
ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif
Canon Cameras: Canon EOS 7D 18MP Digital SLR Camera Canon EOS 50D 15MP DSLR Camera Canon EOS 60D Canon EOS Rebel T2i Canon 1D Mk IV Canon EOS-1Ds Mark III 21.1MP DSRL Camera Canon EOS 1Ds Mark II Body Canon EOS 600D 18MP Digital SLR Camera Canon EOS 1D Mark IV 16MP Digital SLR Camera Canon EOS 5D Mark II SLR CANON LENSES: Canon 10-22 mm EF-S f/3.5-4.5 USM Wide Angle Canon 100 mm EF f/2.8 Macro USM Canon 100-300 mm f/4.5-5.6 USM EF Canon 100-400 mm f/4.5-5.6L EF IS Canon 135 mm EF f/2.0 L USM Lens Canon 15 mm EF f/2.8 Fisheye Lens Canon 16-35 mm f/2.8L USM EF Zoom Canon 17-40 mm f/4 L USM EF Lens Canon Zoom lens - 70 mm - 200 mm - F/2.8 Canon 17-55 mm f/2.8 EF-S IS USM Wide Angle Zoom Canon 17-85 mm EF-S f/4-5.6 IS USM Lens Canon 180 mm EF f/3.5 L Macro USM Lens...
gdgkiuukgklgkjdgkgdhgghsgjkhfejfghjksdbjidshbkfjlndjhkjdnfkjdghuifnbjklfhdisjnfjdhfihjhejhkdlnfjdnfljkrhfiujnlknduiherionfgioehfienmihsdlkfmdkfukdmkduyfkdntdghifjhrjgbiodghjkfnfgjidhjifnrjkovhdjignjrkhfijrngjrghjrbguierygfiu5ntguiryfiorngurehgoirghurehngjkrhguiorhntiorhg8rntgjkfhguoitngijigmtighujtihgmtigujrijtgsopjdfigkjfiogbujtrikgjfiobvjhkrgjmndiohgkrmngkofjhgkotmngkjlfyotjrngjmdgifuhbdkjfhgdgjkdfhjkdhfjshgjerhyuiotyheruyhudjnmd,nvuidfy984yhoen huifyhry9erhfjhdughrgtnr hyeouifyhr tyry rguy ru grtiorhfgir ng r tr u9r fr f9ryurohfdghdfkjhffdjhrwhiorhrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr hrjlklllllllllllqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee...
Workflow Designer Module for electronic Form System Description: We are developing a e Form System using .Net Core and MSSQL. We need a drag-and-drop workflow designer where admins can visually design workflows with nodes, conditions, and actions for different approval processes. The module needs to integrate with our existing system and allow calling existing functions based on actions taken in the workflow. The workflow designer should closely follow the reference images provided. The designer will allow creating, editing, and processing workflows that involve multiple roles and approval stages. Features Required: 1. Drag-and-Drop Designer: - Ability to drag and drop nodes to create workflows. - Connect nodes to form logical paths (e.g., start, decision points, approvals...
I am seeking an experienced WordPress developer to join my team. This role involves converting designs from both Figma and Adobe XD into WordPress, working primarily with custom-made themes. The ideal candidate will not only be proficient in WordPress development but also skilled in technical optimization and performance tuning. Key Res...and Adobe XD into WordPress - Work with custom-made WordPress themes - Optimize site performance (loading times, SEO, server load) - Bug fixing and troubleshooting Key Requirements: - Must be reachable via WhatsApp after an initial Google Meet call - Flexible and self-motivated working style - Hourly rate: Up to €30/hour If this sounds like you, please apply with examples of previous WordPress projects. Let’s schedule a Google Meet to...
I'm looking for an SEO specialist to optimize my website, kubeleprojects.co.za. The goal is to improve search engine rankings in South Africa, boost organic traffic, and enhance visibility for my key services. Key Services for SEO Optimization: - Fencing Installers - Generator Maintenance - CCTV In particular, I would like to focus on: - On-page optimization Ideal Skills & Experience: - Proven experience in SEO, particularly on-page optimization - Familiarity with South African market and search trends - Experience working with service-oriented websites - Ability to deliver measurable results in terms of increased traffic and improved search rankings.
!!!! THIS IS A PRO-BONO JOB - ENHANCE FOR YOUR PORTFOLIO !!!! Company Description HypaMaps is a UK-based company, dedicated to revolutionising the mapping industry with innovative, interactive 3D technology. Our platform enables establishments to create photorealistic scale models of their premises within hours, offering a fully interactive, standalone 3D map experience. We emphasise innovation, adaptability, and customer-centricity in our approach, with a vision to modernise traditional mapping solutions and enhance user engagement. Role Description This is a temporary role for an aspiring, or recently graduated, Visual Effects Artist. This is the perfect project to enhance your portfolio and provide you with The Visual Effects Artist will be responsible for producing a short a...
I'm a newcomer passionate about content writing, particularly in the realm of copywriting. I'm eager to dive into the world of freelance work and build my portfolio. My primary interest lies in copywriting for email marketing campaigns. Ideal Skills: - Exceptional writing and grammar skills - Understanding of marketing principles - Ability to write persuasive and impactful copy - Familiarity with email marketing platforms (e.g., MailChimp, Constant Contact) is a plus Experience: - While I'm new to freelancing, I have a strong passion for writing and a keen interest in marketing. I'm ready to learn and grow with every project. I am looking for opportunities to showcase my skills and dedication. I am open to constructive feedback and committed to delivering high-qual...
I'm seeking a professional, based in UAE, to assist with my referral program. "Referral Offer: Earn AED 200 for Each Successful Referral!" Are you looking to earn extra cash? Here’s an exciting opportunity for you! If you refer a client who successfully avails a loan or credit card through me in the UAE, you’ll receive AED 200 as a reward for your referral. Terms and Conditions: 1. The referral reward will be given only for successful applications. 2. Payment will be processed after the loan or credit card is approved and disbursed/issued. 3. Ensure the client mentions your name during the referral process. For more details or to submit a referral, contact me at [your contact details]. This version is professional, enticing, and includes clear t...
We're seeking a seasoned professional who can maintain our custom-built .NET applications and optimize our use of Microsoft Power Automate. Key responsibilities include: - Maintaining our in-house, custom-built .NET applications. - Designing and implementing automated workflows via Power Automate. - Enhancing our workflow automation processes to boost efficiency and productivity. The ideal freelancer will have a profound understanding of the .NET Framework and Microsoft Power Automate. Experience in designing and implementing automated workflows is crucial.
I'm in need of a video creator based in Kolkata to develop a promotional video targeting local customers. The video will be shared primarily on social media platforms, so expertise in creating engaging, shareable content is crucial. Key Skills and Experience: - Proven experience in video production, ideally with a focus on promotional content - Deep understanding of local culture and consumer behavior - Prior experience creating content for social media platforms - Strong editing skills and proficiency with video editing software - Ability to deliver high quality content on a tight timeline.
...seeking a skilled videographer and video editor based in Delhi for creating a technical and operational video for an industrial machine. This video is intended to educate our customers on how to use, maintain, and repair the machinery. Key Responsibilities: - Filming product demonstrations and operational procedures - Editing footage into a clear, concise, and engaging video - Integrating elements like diagrams, graphics, and 3D models Necessary Skills: - Proven experience in filming and editing technical videos - Proficiency with video editing software - Experience working with 3D graphics and animations The video will include: - Voice-over narration - On-screen text - 3D graphics and animations Ideal Candidate: - Strong portfolio of similar projects - Ability to unde...
I'm looking for a Delhi-based videographer and video editor for a project involving the creation of a product technical and operational video. The primary aim of this video is to educate customers about how to use, maintain and repair the product. Key Responsibilities: - Filming product demonstrations and operational procedures - Editing footage to create a clear, concise, and engaging video with elements like diagrams, graphics and 3D models Necessary Skills: - Experience in filming and editing technical videos - Proficiency with video editing software The video will incorporate: - Voice-over narration - On-screen text - Graphics and animations The ideal candidate should have: - A strong portfolio of similar projects - Experience working with graphics and animati...
I'm seeking a developer to create an Angular-based web application with a Core Web API backend, employing Entra ID for a robust user authentication system. Key Requirements: - Implement Role-based Access Control (RBAC) for user management. - Ensure the application is fully functional on web browsers. Ideal skills for this job include: - Proficiency in Angular and Core Web API. - Experience with Entra ID. - Strong understanding of implementing RBAC in web applications.
I'm in need of an online, Python-based software tailored specifically for my company to create and manage purchase orders. This system should provide a user-friendly interface for both Admin and Staff, with features for easy deduction of quantities as orders are processed. Key Features: - Management of Purchase Orders: The system should allow for easy creation and tracking of purchase orders. - User Roles: The software needs to have access levels for Admin and Staff. - Essential Fields: Each purchase order should include fields for Order Date, Supplier Details, and Product Description. - Core ERP Functionalities: The system should cover basic Inventory Management, Vendor Management, and Customer Management. - Vendor and Customer Management: The ability to add, track, and manag...
Needs to hire 6 Freelancers Sites Requirements: 1. English Sites: As over 30 , Traffic over 10K 2. Site niche: Technology, AI , Education(Targeting students aged 16 and above),Business 3. Need 2-3 do-follow links per post ‼️Send me the sheet including the domain, as, traffic , price, and screenshots ‼️ Screenshots: conversation with the admin shows that he accept the guest post and payment after live link is indexed. ❤Please put all the data information of the above sites into Google Docs. ❤Those who do not provide site data through Google Docs will not be replied to. ❤I will prioritize working with those who have provided all the information. Publish Requirements: 1.✔️ Need 1 do-follow link 2. ✔ Live link must be indexed in Google. Keep articles on site permanently. 3. All cont...
I'm looking for an Engineering Student as intern or experienced Exhibition Coordinator for an upcoming Power Electronics Exhibition in Chennai trade Center at Chennai, India. This individual will play a critical role in ensuring the event runs smoothly and attendees have a positive experience. Key Responsibilities: - Attendee Registration: The coordinator will be in charge of managing all aspects of on-site attendee registration. This includes overseeing the registration desk and ensuring all attendees are checked in efficiently. - Stall Representative: The coordinator will also serve as a stall representative. This involves providing information about our products and services, demonstrating products to attendees, and collecting feedback from attendees. Ideal Skills and Exp...
Create strategy based on chat previous chat
I'm seeking a male collaborator based in the LATAM for a sensitive project involving proxy work. Key Aspects: - The project revolves around service provision. - Potential skills needed include project collaboration, networking Please note, the nature of the project requires discretion and trust. We will discuss details in depth once a suitable candidate is found.
I'm seeking a male collaborator based in the EU for a sensitive project involving proxy work. Key Aspects: - The project revolves around service provision. - Potential skills needed include project collaboration, networking Please note, the nature of the project requires discretion and trust. We will discuss details in depth once a suitable candidate is found.
I'm facing critical user authentication issues with my ASP.NET Zero application. The problem manifests as login failures affecting all users without exception. This is a critical issue that needs to be resolved promptly to restore system functionality and user access. Ideal Skills and Experience: - Extensive experience with ASP.NET...authentication issues with my ASP.NET Zero application. The problem manifests as login failures affecting all users without exception. This is a critical issue that needs to be resolved promptly to restore system functionality and user access. Ideal Skills and Experience: - Extensive experience with ASP.NET Zero - Proficient in troubleshooting user authentication issues - Strong background in .NET development - Able to deliver solutions promptly ...
I'm seeking a seasoned Full Stack Developer with robust experience in JavaScript and Python, adept in both frontend and backend development with a focus on backend at this stage of the project. This project requires someone who can meet with me physically in Pune and assist with th...focus on data retrieval and synchronization. - Implementing and optimizing JavaScript and Python across the project. Ideal candidate should: - Possess strong full stack development skills with extensive experience in JavaScript and Python. - Have a proven track record in backend development. - Be proficient in integrating third-party APIs, particularly for data retrieval and synchronization. - Be based in Pune and available for physical meetings. - Have excellent communication skills and a collabo...
I’m looking for a talented video editor to create a captivating typography-based podcast introduction video. The video should seamlessly blend clips from the podcast episode featuring the host speaker. The video should embody an inspirational tone, with the typography delivering a sense of motivation and positivity. By collaborating on this project, I am excited about the opportunity to build a lasting partnership and work on future projects together. Key elements of the project: - The video should be typography-based, using creative text animations to convey the podcast's themes and energy. - The mood of the typography should be inspirational, appealing to listeners who are looking for motivation and upliftment. - Incorporate my branding elements: the lo...
I'm looking for an experienced web developer and designer to create a visually engaging, media-focused WordPress website for my brand, Treezy. The primary goal of the website is to boost brand awareness, so it needs to effectively represent the brand and appeal to our dual audience of entertainment and education. Key Requirements: - The website must be designed with modern SEO practices in mind to ensure high visibility on search engines. - It should heavily feature video content, as this is the primary type of content we will be sharing. - Brand representation elements include our logo and color scheme, our tagline and messaging, and high-quality images and videos. - The site should be able to handle and showcase high-quality media content seamlessly. Ideal Skills and Experience: ...
...functional desktop application for Windows. The desktop app should replicate the features of the mobile version while being optimized for a desktop environment, with a focus on usability, performance, and a modern design. app link Project Scope Platform: Windows 10 and 11 compatibility. Technology Stack: Preferably .NET Framework (WPF or WinForms), though other Windows-compatible technologies may be considered (C++, Electron, etc.). Key Features: Replicate all features of the mobile app (name and features will be provided). Adapt the UI for desktop users (mouse/keyboard input). Integration with Windows features such as: System notifications. File handling (if applicable). Local storage or database support for saving
...automation enhancements or extensions. The application should run with minimal dependencies and be simple to deploy in a typical Linux environment. Should be able to scale for large datasets or complex automation workflows. Deliverables: A Python-based multithreaded application (or equivalent lightweight language) for automation. Clear documentation on how to install, configure, and use the application. (Optional) Performance optimizations or suggestions for scaling the tool for larger sets of data. Please provide examples of similar automation projects you’ve worked on or any relevant experience with building multithreaded applications for automated tasks. If you have experience working with Linux environments, HTTP requests, and task automation, I’d love to h...
I'm in search of a telecaller to aid in generating international leads for my IT services company. The leads should span both B2B and B2C sectors. I prefer a commission-based payment structure, as this will ensure that your earnings are directly linked to your performance. KEY RESPONSIBILITIES: - Identify and reach out to potential leads across the globe. - Target both businesses and consumers. - Generate leads that are likely to convert into clients. IDEAL CANDIDATE: - Proven experience in telecalling and lead generation, preferably in the IT services sector. - Strong communication skills. - Ability to work on a commission basis.
I'm looking for a comprehensive financial model template for analyzing potential multifamily investment properties. The model should be suitable for use with an LLC and accommodate optionality for multiple partners, as I plan to go in on properties with several investors. Key Requirements: - Essential forecasting metrics: Include Cash Flow Analysis, Net Operating Income (NOI), Internal Rate of Return (IRR), 3-statements, return metrics, and a structure that can handle distributions to multiple equity investors. (my experience is fairly limited here, so I may want something in here to help better analyze deals that I'm not currently aware of and could use someone's expertise.) - Financial Statements: Income Statement, Balance Sheet, and Cash Flow Statement should be ...
I am in need of a RTL design and Verification expert using SystemVerilog and MATLAB to assist with my project. Key tasks will involve:...have front end ASIC design experience, writing RTL and developing verification environment. Demonstrated proficiency in creating UVM test sequences and sequence items, as well as implementing coverage and assertions, will also be highly favorable. End goal is to build over few months a RISC V based Security IP. Understanding my project requirements, applying your expertise to solve the tasks at hand and delivering high-quality results are key to this project's success. Candidates will be selected based on a interview. Looking for someone interested to learn and develop in a team setting. Please watch this video
I am looking for an experienced freelancer who can assist with PLC programming, particularly in TIA Portal, for various industrial automation tasks. Projects may include programming operation of presses, setup of conveyors and robotics systems, and integration of system alarms for temperature control. Each project will vary in complexity; terms and specific requirements will be discussed per project basis. The presses are from 1000 to 2500 tons, they have 3 operations - compression, punching, punching. The company produces bearings for cars, heated cylindrical pieces are compressed (a circle is formed), in the second operation they are punched, the 3rd operation punches out the central part of the circle and a ring is formed, which goes into further processing. The press has the m...
Hello, we need an industrial designer/product developer to assist with the design and prototype for our product idea. We would like to manufacturer 2x 10mm white silicon spheres, which when connected together via magnet, create vibration. Look forward to your assistance. Thanks
I'm looking for a skilled developer experienced in .NET, HTML, and CSS to address few issues in a web application for me. Skills and experience ideal for this job: - Proficiency in .NET, HTML, and CSS. - Experience in developing web applications. - Familiarity with implementing user authentication and payment integration. - Previous work with content management systems. - React Js knowledge is optional, but a plus.
I'm looking for an expert who can find and list trending products on my eBay store. The ultimate goal is anything that sells, so I need products from a variety of categories, including but not limited to electronics, clothing, accessories, and home and garden items. Key Responsibilities: - Utilize market research tools to identify trending products in the United States. - List these products on my eBay store. Ideal Skills: - Proficient in using market research tools. - Previous experience in product sourcing for eBay or similar platforms. - Excellent understanding of eBay's marketplace.
A plataforma será projetada para integrar o armazenamento descentralizado de dados via blockchain com uma interface amigável, possibilitando que usuários armazenem, gerenciem e acessem seus dados de forma prática. Principais Funcionalidades 1. Gestão de Dados: • Upload e download de arquivos. • Organização em buckets personalizados. • Controle de permissões para múltiplos usuários. 2. Integração via APIs: • Compatibilidade com APIs padrão do mercado, como S3 Compatibility, para facilitar a integração com ferramentas existentes. • Automação de fluxos de dados para empresas que desejam armazenar informações diretamente. 3. Das...
A plataforma será projetada para integrar o armazenamento descentralizado de dados via blockchain com uma interface amigável, possibilitando que usuários armazenem, gerenciem e acessem seus dados de forma prática. Principais Funcionalidades 1. Gestão de Dados: • Upload e download de arquivos. • Organização em buckets personalizados. • Controle de permissões para múltiplos usuários. 2. Integração via APIs: • Compatibilidade com APIs padrão do mercado, como S3 Compatibility, para facilitar a integração com ferramentas existentes. • Automação de fluxos de dados para empresas que desejam armazenar informações diretamente. 3. Das...
...Manager (PM [Allen Pitts]). The Fusion version on the PM's laptop is 2.0.20981 x86_64 running on Windows 11. 2. The Contractor provides a not very detailed, but reasonably detailed explanation of how the SPS was drawn in Fusion. The explanation should be just detailed enough to allow the PM to maintain the SPS when the Contractor is no longer engaged. SPS Specs 1. The Seven point Star (SPS) is a based on a regular geometric shape, a heptagon. An image titled Light Blue SPS is attached. 2. The diameter of the SPS heptagon circle should be about 204 mm (eight inches). 3. The SPS should have seven Stems where each stem is two irregular triangles that are symmetric about a common hypotenuse. Where the common hypotenuses meet at the most acute angle they lie on plane that i...
Hi Sameen, Key requirements: - Experience with Shopify - Ability to create a user-friendly and attractive one-page site - Knowledge of e-commerce best practices - Use our branding pack complete with fonts, graphics, colours and images this is to complete the website in a mix of styles : or using spotify Everthing as discussed in previous message
I'm looking for a talented programmer with experience in blockchain technology who can create a meme coin for me on the Solana network. Key Aspects of the Project: - Creation of a basic token with a fixed supply. - Integration of pre-existing logo into the coin. Ideal Skills and Experience: - Proficient in blockchain programming, particularly on Solana. - Experience in token development. - Ability to integrate custom assets into the project.
I'm seeking a proactive professional for outbound prospecting on behalf of my marketing company. The task involves using a designated email address to connect with specific brands and target audiences. Key Responsibilities: - Prospecting CPG Brands, Retail, Travel, Finance, and Consumer Facing companies with a net revenue of over 5M. - Targeting key decision-makers, including Brand Managers, Directors, Marketing Managers, Promotions Managers, and Assistant Brand Managers. - Setting up meetings using Microsoft products. Skills and Experience: - Prior experience in outbound marketing or prospecting. - Proficiency with Microsoft products. - Access to a current list of relevant brands. - Excellent communication skills, with the ability to convincingly represent our company. - ...
We have few job positions opened in Houston, Texas. If you are based in Houston please bid and we can discuss. Jobs include product researcher, customer support rep, sales manager etc
We are seeking an experienced civil engineer who specializes in land development and construction projects to collaborate with our team on a regular basis. Responsibilities include advising on site planning, compliance with local regulations, design optimization, and overseeing project execution. The ideal candidate will have a strong background in both the theoretical and practical aspects of civil engineering, with a focus on sustainability and innovation in land development.
I need a skilled professional to design and develop a consumer electronics product with a modular design, suitable for retail market. The project involves creating small (5x5 cm) PCB modules, each using edge connector. Key Responsibilities: - PCB Design: Your primary focus will be on designing the PCBs for each module. - Schematic Development: You will need to create a schematic diagram for each module. - Firmware Development: You will develop firmware tailored to the needs of each module. - Testing: At the conclusion of the project, you will conduct testing to ensure that all schematics, PCBs, and firmware are correctly designed and can be integrated as needed. Ideal Candidate: - Proven experience in PCB design is a must. - Prior work with small PCB modules is preferred. - Ski...
I'm seeking skilled Software Developers specializing in Web Development for multiple upcoming projects. The nature of these projects varies, including but not limited to E-commerce, Blogs, and Corporate websites. Ideal candidates should possess: - Proficiency in various web development languages and frameworks - Experience in creating diverse types of websites - Excellent problem-solving skills - Ability to work on different projects concurrently Your portfolio should showcase a range of web development projects. Looking forward to your proposals.
I'm looking for experienced blockchain developers to help develop a large-scale DeFi platform on the Ethereum blockchain. The ideal candidates should be well-versed in DeFi and understand its intricacies. Key requirements: - Proficient in Ethereum blockchain - Experienced in DeFi development - Capable of creating a large-scale platform Please note, I need to hire as soon as possible.
Looking for an Electronics Engineer We need a circuit designed to interface with an ESP32. The circuit should be capable of transmitting and receiving logic 1 and logic 0 commands via a two-wire current loop interface. It must support full-duplex communication, meaning it should also be able to receive responses. Logic Explanation: Based on the attached specifications: 1. Logic 0 ("Space"): Current: Between 0 mA (Minimum) and 2 mA (Maximum). 2. Logic 1 ("Mark"): Current: Between 42.75 mA (Minimum) and 47.25 mA (Maximum). The current loop operates at a nominal 45 mA ±5%. The voltage for the open-loop supply must be between 12V DC (Minimum) and 42V DC (Maximum). Requirements: The designed circuit must handle current regulation for trans...
I'm in need of a talented 3D designer who specializes in product modeling. The primary focus will be on creating models for consumer electronics and furniture, aimed at marketing and advertising purposes. The ideal candidate should have a strong portfolio in product modeling, with experience in creating visually appealing and accurate models that are suitable for promotional use. Skills in character design and architectural visualization are not necessary but would be a plus.
I'm looking to establish a comprehensive electronic store targeting major platforms like Amazon and Shopify. Key Responsibilities: - Importing products from wholesalers: Sourcing and drop shipping electronic products. - SEO: Implementing effective search engine optimization strategies to boost visibility and sales. - Social Media Advertising: Primarily on Amazon and Shopify. Ideal Skills: - E-commerce experience: Particularly with Amazon and Shopify. - Product sourcing: Proven track record in importing from wholesalers. - SEO expertise: Able to devise and implement effective SEO strategies. - Social Media Marketing: Experience in promoting products on e-commerce platforms. Target Markets: USA, UK, Saudi Arabia, UAE, Iraq. Your expertise in these areas will significantly contribu...
