Filtër

Kërkimet e mia të fundit
  • access active directory vb net
Filtro sipas:
Buxheti
deri në
deri në
deri në
Lloji
Aftësitë
Gjuhët
Shteti i punës
2,000 access active directory vb net u gjetën punë
Project for Diellza R.
Ka përfunduar left

Qysh je qa bone deshta me te pyt a din me mnimu ne ReactJS me bo 1 searchbox me hooks qe ka access ndatabase(firebase). vetem kjo funcionality po mvyn me shtu.

€19 Average bid
€19 Oferta mesatare
1 ofertat
Project for Ardit H.
Ka përfunduar left

Qysh je qa bone deshta me te pyt a din me mnimu ne ReactJS me bo 1 searchbox me hooks qe ka access ndatabase(firebase). vetem kjo funcionality po mvyn me shtu.

€19 Average bid
€19 Oferta mesatare
1 ofertat
Programing
Ka përfunduar left

Programing in Dot Net & SQL Server. Visual Studio 2010, SQL Server 2012 Express ose më të avancuar. Modify existing modules, add modules, design interface, Reports...etc

€11546 Average bid
€11546 Oferta mesatare
4 ofertat
Crie um Website
Ka përfunduar left

Desenvolvedor .NET MVC, SQL e ADVPL Protheus

€2804 Average bid
€2804 Oferta mesatare
1 ofertat
qefqreqweqawdafsc
Ka përfunduar left

asdafwrgwrgwrgqwqfrwqdvkqwavsdkjcqabcjbsadjcbwjbdckjbsd,vb,jsdbvj,bdflkblefdblvjdbkjfbvkjefblvjbwlfbljwbsjgbljwr

€189 Average bid
€189 Oferta mesatare
1 ofertat
yveguwvcjnjnecbkhb
Ka përfunduar left

ujfuhjkrjif dfgh gh ghi yui h oij wdhj oijr hj oi ghj erpo oijh ghj dpoikj irfoihjog huhuh bjbnjbn njhfnubib jbjebwb bhbuoh jnbbuib cvfcc yg y bbhuihiu hbyi buybgi uyghy whwp lkoof vcbxnm cvbn bnm, nm ghjk uio weer 67 09 wdef okj hjdkl er sdfg xcv po ,mn ljh hf e c bnm, m,,,,,, hhjkl fghjk sdfg cvbn wert rtyu vb b nk k k k k k k k k k k k fj jnijerijoopoieqerjgi80t02222222222222222222222222222222222222222222222222224rhjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif

€108 Average bid
€108 Oferta mesatare
1 ofertat

I need a skilled Android app developer to help me fix bugs and upgrade my app to the latest version. I have full access to the app's source code. I have source code, its on react native, of android app that sends and receives sms and communicate with api. There is play button to run the app for working , I need this app start working on clicking on play button and runs until user clicked on stop button in the app , it should work after closing this app , it should work in background without draining battery. Need to upgrade version of code too ( if possible ).

€34 Average bid
€34 Oferta mesatare
5 ofertat

...infrastructure (Flashbots, SUAVE, relays, builders)** or Solidity/ development. --- ### **? Why Join Us?** ? **High-impact project** in the **MEV & Ethereum Staking ecosystem**. ? Opportunity to work with **top blockchain experts, MEV devs, and quant traders**. ? Competitive salary + potential **tokens and equity**. ? Full flexibility: **remote** or hybrid work based on your preference. ? Access to top-tier **DevOps infrastructure** and technological freedom. --- ### **? Start Date: ASAP – We move fast!** ? **Contract Type**: Full-time / Freelance ? **Location**: Remote / Hybrid ? **Salary**: Based on experience + potential tokens **➡️ Interested?** Send us your GitHub / Portfolio / Blockchain experience ? --- **Join us and optimize the infrastructure tha...

€3001 - €5001
I cilësuar I vulosur
€3001 - €5001
18 ofertat

...DELIVERABLE: a. Multisite Plugins must work in domain and subdomain without issues. b. ONE Shared database for all products, events, courses on domain and subdomain c. SAME Shared database (as stated in b.) for customer data and purchases so customer account in main syncs with subdomain's customer account. d. LIMIT THEME DEVELOPER'S ACCESS to each other's file. :: Setup file permissions and FTP so if Porto (main) developer needs to fix a theme issue, Porto developer cannot access HiStudy (subdomain) files. e. Stripe is installed in main and works but does not work in Subdomain. :: Fix issue so Stripe works on subdomain. This project WILL NOT BE COMPLETE UNLESS ALL INSTALLED MULTI SITE PLUGINS WORK: 1. Currency Switcher - show all currencies on header on b...

€142 Average bid
€142 Oferta mesatare
22 ofertat
Business Verification in Maldives
6 ditë left
Të verifikuara

...names, etc. • Take pictures of the subject company and its vicinity per Confirmis’ standard operating guidelines. • Provide observation about the company to gauge activeness, e.g., staff working at the premise, loading/unloading of goods, etc. REQUIREMENTS: • Must be living in (or nearby) M. MHA BUILDING, 1/0 ORCHID MAGU, Maldives • Has a camera or phone/tablet of quality with a camera, internet access • Must be available during business hours (9 AM - 4 PM) on working days Please see the attached file for the site visit guidelines. You are only required to deliver the pictures, video & observations and are not expected to assemble a report like the Sample Report. Note: Milestone will be released the following week after the site visit to give...

€14 - €24
Lokale
€14 - €24
0 ofertat

...property owners, hence a comprehensive understanding of both user perspectives is vital. Key Features of the App: mobile application designed to streamline building management operations, communication, and service requests for building administrators, tenants, and internal staff. The app will facilitate efficient management of various building-related tasks, including maintenance, repairs, guest access, and payments, all managed internally by the building administrator and their personnel. Platform: The app ux should be designed for iOS or Android, Ideal Skills and Experience: - Extensive experience in UX design, particularly for mobile apps. - Understanding of property management processes and terminology. - Ability to create designs from the perspective of different user ...

€56 Average bid
€56 Oferta mesatare
24 ofertat

...include features like credit monitoring, rent and utility payment reporting, secured credit card integration, and financial education. Responsibilities: Develop a cross-platform mobile app using React Native or Flutter (or native iOS/Android if preferred). Integrate credit bureau APIs (Experian, Equifax, TransUnion) for credit reporting. Implement Plaid or similar APIs for secure financial data access. Ensure secure authentication (OAuth, biometric login, encryption). Build a user-friendly dashboard for credit monitoring and financial insights. Work on push notifications, financial education modules, and alerts. Requirements: ✅ Proven experience developing mobile apps (iOS & Android) ✅ Experience integrating financial APIs (Plaid, credit bureaus, banking data) ✅ Stro...

€971 Average bid
€971 Oferta mesatare
98 ofertat

I'm in a bind as I've lost admin access to my WordPress site. I need a professional to take a look and see how we can recover it. - Limited Database Access: I have limited access to the database, so some troubleshooting may be possible from there. - Previous Attempts: I've already tried resetting the password via email, but to no avail. Ideal Skills: - Extensive experience with WordPress - Database management skills - Proven track record in website recovery I appreciate your urgent attention to this matter. Thank you!

€118 Average bid
€118 Oferta mesatare
128 ofertat

I'm in need of a skilled developer who can troubleshoot and fix connection problems related to IAM access in my API REST setup. I've already implemented some features, but I'm facing issues with authentication errors and connection failures. Key Tasks: - Diagnose the root cause of the "Missing Authentication Token" messages - Ensure proper linking of API Gateway and DynamoDB - Fix IAM access issues Ideal Skills: - Extensive experience with AWS services, particularly API Gateway and DynamoDB - Strong knowledge of IAM roles and permissions - Proficient in troubleshooting API connection problems - Expertise in RESTful API development

€31 Average bid
€31 Oferta mesatare
8 ofertat

My Windows 10 OpenSSH's SSHD service isn't starting automatically and only works when I manually run -d. I've installed OpenSSH, configured firewall rules, and attempted restarting the SSHD service, but it fails to start. I'm encountering an "Access Denied" error when trying to start the SSHD service, despite changing file permissions, running as an administrator, and modifying service settings. I need an expert in OpenSSH on Windows to troubleshoot and fix this issue ASAP. Bonus if you can deliver a quick solution! Skills and experience required: - Extensive knowledge of OpenSSH on Windows - System troubleshooting and problem-solving skills - Experience with Windows Event Viewer - Ability to deliver quick solutions.

€110 Average bid
€110 Oferta mesatare
13 ofertat
Masjid during day
6 ditë left

I'm in need of a mobile, Android-compatible photo editing application that can perform both basic and advanced editing functions. Key Features: - Basic Editing: The application should allow users to crop, rotate, and resize their photos. - Advanced Editing: Users should also have access to a variety of filters and effects to enhance their images. Ideal Skills: - Mobile App Development: Proven experience in developing user-friendly, efficient mobile applications. - Photo Editing Software Knowledge: Familiarity with existing photo editing software to incorporate similar functionalities. - Android Development: Expertise in creating applications specifically for the Android platform.

€17 Average bid
€17 Oferta mesatare
15 ofertat

Features to Implement: 1. User Registration and Authentication a. Implement user registration with email verification. b. Social media login (Google, Facebook, etc.) for quick access. c. Secure user authentication using OAuth or JWT. d. User profile management including name, profile picture, and email. 2. Dashboard for Users a. Display ongoing and completed group cards. b. Option to create a new group card. c. Manage existing group cards (edit, delete, share links). 3. Group Card Creation Process a. Step 1: Create a Group Card i. Input title, description, and occasion (e.g., birthday, farewell). ii. Set deadlines for contributions. iii. Upload cover image or select from pre-designed templates. b. Step 2: Add Contributors i. Invite contributors via email or shareable link. ii. Set p...

€463 Average bid
€463 Oferta mesatare
41 ofertat
Web User Management Interface Development
6 ditë left
Të verifikuara

I'm seeking an expert who can create a web user management interface for my custom system. The interface should include: - User Registration and Login: A seamless, user-friendly registration and login process is crucial. - User Profile Management: Users should have the ability to manage their profiles, including updating pers...service integrations authentication. we will discus that later. Users and groups are saved into text files and , which the system will read. The system is on a Linux server. Ideal Skills and Experience: - Proficient in web development, with a strong focus on user interface design - Experienced in creating user management systems - Knowledgeable in implementing role-based access control - Able to develop secure, local-only authentication systems

€148 Average bid
€148 Oferta mesatare
72 ofertat

I need to integrate MTN Mobile Money into my Deep Sound music streaming website and Mobile App. This payment gateway should support subscription payments and one-time purchases. It's crucial that all users, regardless of their subscription status, have access to this payment option. Key Features: - Compatibility with all user roles: The payment system should be accessible for free users, active subscribers, and everyone in between. - Flexibility with payment details: Users should have the option to decide whether they want to save their payment details for future transactions or not. Ideal Skills: - Experience with MTN Mobile Money integration - Proficiency in website payment system implementations - Knowledge in user interface design for payment systems Your bid sho...

€21 Average bid
€21 Oferta mesatare
12 ofertat
Trophy icon Premium Coffee Packaging Design
4 ditë left

...DD/MM/YYYY). 3. Back Packaging Elements (Main Box) 1. Product Story (Use Emboss for the Coffeur®️ name in the text for visual impact): • “Coffeur®️ is specially crafted for those who prioritize health without compromising taste. Formulated with a blend of 100% Arabica coffee beans, MCT Oil for sustained energy, and Stevia as a natural sweetener, this product is the perfect choice for a healthy and active lifestyle.” 2. QR Code & Barcode (Use Spot UV for QR Code border to make it stand out): • Place a QR code to direct customers to Shopee or the official product website. • Add a barcode for product verification. 3. Company Information (Address & Contact Info): • Coffeur®️ Sdn Bhd 123, Virtual Business Center, Jalan U...

€38 Average bid
I garantuar
€38
89 kandidaturat

...and interactive user interface. Core Technical Systems Inventory & Product Management System The Inventory System ensures seamless tracking and organization of products throughout the auction lifecycle. Key Features: Product Details: Name, entry date, display date, exit date Purchase price, selling price, collection percentage Seller and buyer information Product cost and status (e.g., active, sold) Product Status Tracking: Monitors the product from entry to sale, ensuring smooth transitions. Upcoming Products: View products scheduled for upcoming auctions. Favorites: Users can mark products as favorites to receive notifications. Billing & Balance System The Billing System simplifies financial transactions between buyers, sellers, and the platform. Key Feat...

€252 Average bid
€252 Oferta mesatare
18 ofertat
New strip on Wix site
6 ditë left
Të verifikuara

I want the strip at the top of this home page complete with animated text on my wix site. Budget $10 I will give you access to wix to complete it You will create the strip with its three slides and any holding images. I have attached a screenshot for clarity.

€23 Average bid
€23 Oferta mesatare
30 ofertat

I'm seeking a skilled web developer/designer to enhance my current Woocommerce site (). The primary focus is on making the site more mobile and...playful and vibrant. - Easy Management: I need a user-friendly backend that allows me to effortlessly update campaign images. In addition to the design and usability enhancements, I'm also looking to prepare the site for B2B operations. This involves: - Creating a B2B Login: A dedicated section for B2B customers is needed. - Application Form: An application form that customers can fill out to gain access to B2B pricing. Experience with Woocommerce and WordPress is essential, as well as a solid portfolio of visually engaging, mobile-responsive sites. Familiarity with B2B e-commerce is a plus. Looking forward to your proposals.

€136 Average bid
€136 Oferta mesatare
114 ofertat
SSH Access Setup on Linux
6 ditë left
Të verifikuara

I need assistance in setting up SSH access on my Linux server. Only with anydesk, right now Ideal Skills: - Proven experience with SSH configuration - Ability to generate SSH keys and setup user permissions Please note, I may require further assistance with configuring the SSH server and setting up user permissions depending on the project progress. Therefore, having a proactive approach and excellent troubleshooting skills will be a plus.

€21 Average bid
€21 Oferta mesatare
16 ofertat
Cross-Platform Medical Exam Prep App
6 ditë left
Të verifikuara

...(Google Play Billing, Apple StoreKit). Key Features: For all users (free): Access to 1 random quiz per day. Premium Subscription (to be developed as a priority): Unlimited access to all categories and quizzes. "Simulated Exam" mode (timed, real exam format). Detailed statistics (progress by category, average response time). Quiz downloads for offline use. PDF study sheets by topic. Additional Features: Reward system (badges, streaks). Anonymous community leaderboard. Push notifications for training reminders. 4. Design & User Experience (UX): Minimalist UI: Focus on educational content (e.g., professional colors like medical blue, readable fonts). Simplified User Flow: Registration in max 3 steps, one-click quiz access. Accessibility: Dark mode, text...

€411 Average bid
€411 Oferta mesatare
69 ofertat

We wants a dealer B2b Portel on our website. Our business is in tyres and module is from wholesale channels to retail channels. Can you make a Portal like below features. Customer Number aprox 300 Skus - 5000 1. Dealer Login System – Secure access for registered customers. 2. Product Catalog – Display available tire models, sizes, brands, and pricing. 3. Real-time Stock Availability – Ensure customers see up-to-date inventory. 4. Order Placement – Allow customers to add items to a cart and submit orders. 5. Credit Limit Tracking – Show available credit limits for each dealer. 6. Order History & Tracking – Let dealers check past orders & delivery status. 7. Custom Pricing – Different pricing tiers based on customer agreements. 8. Re...

€521 Average bid
€521 Oferta mesatare
130 ofertat

I am looking for an experienced Laravel Developer to integrate a subscription-based s...Developer to integrate a subscription-based system into the MCMCorner platform. The ideal candidate should have a strong background in Laravel, payment gateway integration, and subscription management. Responsibilities: Develop and integrate a subscription model in the MCMCorner platform. Implement recurring payments using Stripe, PayPal, or another payment gateway. Ensure user role management and access control for different subscription tiers. Optimize database interactions for efficient subscription handling. Troubleshoot and fix any bugs or performance issues related to the subscription system. Provide API endpoints for frontend subscription handling. Write clean, secure, and maintainable Lar...

€1145 Average bid
€1145 Oferta mesatare
1 ofertat
Comprehensive Odoo Setup for Our Company
6 ditë left
Të verifikuara

I'm looking for an experienced Odoo profe...customer support portal and automated responses) - HRMS & Payroll (for Human Resources, Finance and Operations) - GST Setup (with reports and GST filings) - Ewaybill and einvoice setup - Access rights configuration (Read-only access, Modify access, Full administrative access across various modules) - Reports generation - Data transfer from current ERP The ideal freelancer for this project would have: - Extensive experience with Odoo setup and configuration - Strong understanding of accounting, inventory, HRMS and helpdesk systems - Ability to implement GST, Ewaybill and einvoice setups - Proficiency in configuring access rights and generating comprehensive reports - Excellent communication skills to un...

€109 Average bid
€109 Oferta mesatare
6 ofertat
Android App Bug Fix & Version Upgrade
6 ditë left
Të verifikuara

I need a skilled Android app developer to help me fix bugs and upgrade my app to the latest version. I have full access to the app's source code. Ideal Skills: - Android app development - Bug fixing - Performance enhancement - UI/UX improvement Key Tasks: - Identify and resolve existing bugs - Improve app performance and UI/UX - Upgrade app to the latest Android version Please note, I have skipped answering some questions regarding the specific bugs and Android version. The successful freelancer will need to diagnose the issues and determine the appropriate upgrade.

€26 Average bid
€26 Oferta mesatare
13 ofertat

... and we're not appearing in relevant search results. We want to ensure potential clients and partners can easily find information about us. Key Aspects: - Off-page SEO: We need someone who can boost our visibility through effective off-page strategies. - Link Building: We want to improve our website's authority by acquiring backlinks from reputable sites. - Social Media Marketing: We have an active YouTube channel and presence on other platforms, but we need help crafting a strategy to engage our audience and reach potential clients. - Guest Blogging: We are open to leveraging this strategy in a well-planned manner. Content Creation: We need help creating engaging content for link building and social media marketing. This includes: - Articles and Blogs: We need well-...

€355 Average bid
€355 Oferta mesatare
84 ofertat
AWS Design for Web App
6 ditë left
Të verifikuara

I'm looking for an AWS architecture expert who can help design security for a simple web application. The application uses API Gateway and Lambda Authoriser for security. Key Requirements: - Designing a robust access control system. - Implementing OAuth for user authentication (if good) - Incorporating best practices for AWS security. Ideal Skills: - Extensive experience with AWS, particularly API Gateway and Lambda. - Deep understanding of OAuth and access control mechanisms (if good) - Proven track record in designing security for e-commerce applications.

€142 Average bid
€142 Oferta mesatare
61 ofertat

...Key Features: - Job Matching: A highly curated job-matching experience, ensuring candidates align perfectly with the right corporate opportunities - Candidate Validation: A structured recruitment process that validates and curates data for precision in job placement - Career Guidance: Tailored career guidance for global job seekers Our platform is intended for Employers primarily, providing them access to a diverse, high-quality talent pool. Unlike traditional job platforms, Wathifa offers a streamlined, 'noise-free' alternative to networking sites like LinkedIn, ensuring a top-tier recruitment experience. Ideal Skills and Experience: - Extensive knowledge in platform development - Experience in the recruitment industry - Ability to create a 'noise-free' jo...

€7081 Average bid
€7081 Oferta mesatare
58 ofertat

Wathifa ...provides a highly curated job-matching experience, ensuring candidates are precisely aligned with the right corporate opportunities. Wathifa sources skilled professionals from around the world and connects them with MENA-based employers in finance, technology, marketing, and more. Our platform ensures that global job seekers receive tailored career guidance while companies in the MENA region gain access to a diverse, high-quality talent pool through a validated and structured recruitment process. Our platform differs from other networking mechanisms like LinkedIn by being a streamlined, “noise-free” alternative. We curate and validate the data, ensuring precision in job placement. Subscribed candidates will be supported and guided until they achieve their ...

€6795 Average bid
€6795 Oferta mesatare
39 ofertat
Next.js Dashboard Panel Development
6 ditë left
Të verifikuara

...Collaboration: ○ The freelancer will be expected to continue providing paid updates and feature additions after the project’s completion. ○ We plan to maintain an ongoing collaboration for improvements, troubleshooting, and implementing new functionalities as needed. 4. Additional Notes: ○ The freelancer should be experienced with designing and implementing secure user authentication and role-based access control. ○ The final product should have a clean codebase to facilitate future maintenance and scalability. ○ Recommendations for efficient deployment strategies or CI/CD pipelines are appreciated. If you are interested and have relevant expertise, please include examples of previous similar projects in your proposal. We are looking for a proactive collaborator who can b...

€498 Average bid
€498 Oferta mesatare
147 ofertat

I'm looking for an experienced Erlang developer who has substantial knowledge of FreeSWITCH and can help me customize it for my VoIP/SIP server. Key Responsibilities: - Understand the existing FreeSWITCH components and customize them to meet my needs. - Potentially work with components like the Directory, Dialplan, and Event Socket. - Customization of an existing open source freeswitch project that is in Erlang and C. Ideal Skills: - Strong expertise in Erlang programming - Proven experience with FreeSWITCH customization - Understanding of VoIP/SIP server setup and requirements The project is urgent and I look forward to receiving your bids. Please ensure you have relevant experience and can demonstrate your proficiency. I am looking for a candidate to resolve the problem...

€366 Average bid
€366 Oferta mesatare
16 ofertat

It seems like there was no specific context provided in your message apart from the phrase "dot net project mvc." However, I can provide you with some general information about .NET projects using the Model-View-Controller (MVC) pattern. ### ASP.NET MVC Overview ASP.NET MVC is a framework for building web applications using the Model-View-Controller design pattern. This pattern separates an application into three main components: 1. **Model**: Represents the application's data and business logic. It is responsible for retrieving data from the database, validating data, and defining the rules for data manipulation. 2. **View**: Represents the user interface of the application. It displays the data provided by the model and sends user commands to the controll...

€31 / hr Average bid
€31 / hr Oferta mesatare
78 ofertat

We are looking for a Technically Qualified Person (TQP) with a degree in Food Technology, Hotel Management, Microbiology, Biochemistry, or any FSSAI-approved field to act as the Food Safety Consultant for our FSSAI license application. Responsibilities: ...(degree/diploma) for FSSAI registration. • Be listed as the Technically Qualified Person (TQP) in the FSSAI license application. • Offer basic guidance on food safety compliance (if required). Requirements: ✔ Must have a degree/diploma in Hotel Management, Food Science, Microbiology, Biochemistry, or related fields. ✔ Willing to be appointed as the food safety consultant in the FSSAI application. ✔ No active role required—this is for compliance purposes only. ✔ Experience in FSSAI compliance (preferred but not...

€7 - €16
€7 - €16
0 ofertat

I am looking for a seasoned marketing professional to spearhead a Meta (Instagram & Facebook) campaign aimed at generating leads fo...market - Establish our project as the foremost luxury real estate investment on the island Requirements: - Expert-level Meta (Instagram & Facebook) targeting skills: This includes advanced audience segmentation, retargeting, and lookalike audiences to connect with high-net-worth individuals and potential investors. - Proven ability to increase social media following, website traffic and lead generation. The ideal candidate should possess: - Extensive experience in real estate marketing - Demonstrated success in targeting high-net-worth individuals - Proficiency in audience segmentation on Meta platforms - Strong track record of lead g...

€158 Average bid
€158 Oferta mesatare
33 ofertat

I use WooCommerce and Fooevents in wordpress to sell event tickets. I want the pdf and QR codes of the tickets to be shown on the thank you page once the purchase is done, even if you don't have an account (you can buy without registering). I need a plugin or a modification that allows this. Fooevents does not allow this, it only gives you the option of a link to your acc...without registering). I need a plugin or a modification that allows this. Fooevents does not allow this, it only gives you the option of a link to your account and look for them there, that does not work for me. The Fooevents plugin will be provided (it is not free). Must do the work on your own server with wordpress, woocemmerce and fooevents, and send the solution to run on my own server. No access is give...

€125 Average bid
€125 Oferta mesatare
84 ofertat
Market Researchers in Boston, USA -- 4
6 ditë left
Të verifikuara

I am seeking researchers in Boston, USA to conduct market research for a retail audit. The ideal candidate should have good communication skills and access to a smartphone and be able to complete the project in 1 week. You must be available immediately. You will visit 30 bars in the city of Boston, USA and the payment for this project is €420. For this project, the product cost and materials needed to assess the product will be reimbursed. Specific requirements for the project include: - Conducting a retail audits in Boston, USA - Collecting data on consumer behavior and preferences Skills and experience needed for this project: - Strong analytical skills - Excellent communication skills - Ability to finish the project by a specific deadline - Flexible schedule Please get i...

€410 - €420
Lokale
€410 - €420
0 ofertat
Remote Desktop Services Setup for PAM
6 ditë left
Të verifikuara

I'm looking for a professional to set up a Remote Service Desktop Server and RD Connection Broker on Windows Server 2019, with the primary goal of streamlining remote access for our Beyond Trust PAM (Privileged Access Management) setup. Key Responsibilities: - Configure the Remote Service Desktop Server and RD Connection Broker on Windows Server 2019. - Ensure the setup is optimized for smooth and efficient remote access. Ideal Skills and Experience: - Proven experience with Windows Server 2019. - Deep understanding of Remote Desktop Services (RDS). - Prior experience with Beyond Trust PAM is a plus. - Excellent troubleshooting skills to ensure minimal downtime and maximized efficiency.

€109 Average bid
€109 Oferta mesatare
10 ofertat
Discreet Site Visit
6 ditë left
Të verifikuara

I'm looking for a reliable individual to assist with discreet site visits. This will involve taking pictures and gathering some information about a specific company and its surroundings. Key Responsibilities: - Conducting discreet visits to a specified location - Taking photographs of the building (inside and outside), the nearby area, and the business directory - Gathering information on the company and its operations Ideal Skills: - Strong observational skills - Experience in market research and competitor analysis - Ability to handle tasks discreetly and professionally - Proficiency in taking quality photographs Your assistance will be crucial in providing insight into competitor operations and the surrounding environment.

€48 - €95
Lokale
€48 - €95
0 ofertat

I am seeking a skilled web developer to create a comprehensive website aimed at providing information ...web developer to create a comprehensive website aimed at providing information for various types of events, specifically concerts, conferences, and festivals. Key Features: - The site will primarily serve to disseminate event-related information, including but not limited to, the event schedule and location details. - Each event entry will need to be meticulously detailed, ensuring visitors can access pertinent information effortlessly. Ideal Skills: - Proficient in web development languages (HTML, CSS, JavaScript, etc.). - Experience with creating user-friendly, intuitive website layouts. - Knowledge of event management systems would be a plus. I look forward to seeing your ...

€263 Average bid
€263 Oferta mesatare
37 ofertat

About the Role: We are looking for Arabic-speaking (Egypt preferably) influencers to become brand ambassadors for Exnova, a leading trading platform. If you have an active social media presence and a passion for finance, investing, or lifestyle content, this is a great opportunity to collaborate! Responsibilities: Create high-quality content (videos, stories, images, and other promotional materials) for Instagram, TikTok, YouTube, and Telegram. Promote Exnova’s features, benefits, and success stories through engaging and educational content. Collaborate with our team to develop innovative campaigns and interactive formats. Drive audience engagement and increase brand awareness. Requirements: Strong presence on at least one of the following platforms: Instagram, TikTok, YouT...

€805 Average bid
€805 Oferta mesatare
4 ofertat

I'm looking for a skilled .NET MAUI developer to create a mobile application for both Android and iOS. This application will connect to a Bluetooth device that reads blood pressure, storing the data on the phone and displaying it in both a graph and a table. The data will also need to be sent to a specific server at designated intervals. Key Features: - Read blood pressure data from a Bluetooth device - Store data locally on the phone - Display data in a table and a graph (specifically a line graph) - Send data to a specific server - Use a graphically rich interface Ideal Skills: - Proficiency in .NET MAUI - Experience with Bluetooth connectivity in mobile applications - UI/UX design skills for creating a graphically rich interface - Knowledge of data transmission to s...

€516 Average bid
€516 Oferta mesatare
57 ofertat

...reflexometer using Raspberry Pi. The project should meet the following specifications: Number of Reflex Buttons: The reflexometer should have at least 6-9 buttons that can be pressed to measure reflexes. These buttons should be connected to the Raspberry Pi in a way that allows for precise timing and response detection. Backlight: The buttons should feature backlighting to indicate their active state. This should be adjustable or customizable based on the reflex test settings. LCD Display: The device should include an LCD screen (preferably a 16x2 or 20x4 character display) to show menu options and different modes of operation. The display should be clearly readable and should be able to indicate important information about the test or reflex response time. Me...

€166 Average bid
€166 Oferta mesatare
22 ofertat

...establishing robust access control management. Key Responsibilities: - Install and configure Fortinet NAC virtual server - Conduct thorough testing and commissioning - Apply and implement group security policies - Develop and manage user policies - Monitor and analyze network logs User Policies: - Guest access policies - Employee access policies - Contractor access policies Group Security Policies: - Role-based access control - Time-based access control - Device-specific access control Ideal Skills and Experience: - Extensive experience with Fortinet NAC - Strong understanding of network security - Proficiency in developing user and group security policies - Excellent skills in network monitoring and log analysis - Experience with rol...

€569 Average bid
€569 Oferta mesatare
14 ofertat

I'm looking for a professional web developer to create a single page website for my course selling business. The primary goal of this site is sales and conversion. It should be optimised for driving purchases and have an engaging layout that captures potential customers' attention. Key Requirements: - A well-designed single page layout that facilitates easy navigation and quick access to information. - An e-commerce setup that is optimised for sales conversions. - Integration of multiple payment methods including Credit/Debit cards, PayPal, Bank transfer, Paytm UPI, and Phonepay. Ideal Skills and Experience: - Proven experience in creating single page websites, particularly for e-commerce or course selling businesses. - Strong knowledge of payment gateway integration. -...

€91 Average bid
€91 Oferta mesatare
55 ofertat

I'm looking for a professional web developer to create a single page website for my course selling business. The primary goal of this site is sales and conversion. It should be optimized for driving purchases and have an engaging layout that captures potential customers' attention. Key Requirements: - A well-designed single page layout that facilitates easy navigation and quick access to information. - An e-commerce setup that is optimized for sales conversions. - Integration of multiple payment methods including Credit/Debit cards, PayPal, Bank transfer, Paytm UPI, and Phonepay. Ideal Skills and Experience: - Proven experience in creating single page websites, particularly for e-commerce or course selling businesses. - Strong knowledge of payment gateway integration. - ...

€113 Average bid
€113 Oferta mesatare
32 ofertat