Vba access 2007 open report saveJobs

we need opencart 2.0 full support and mobile phone whit out any code errors templates for online fashion stores. + Design a Logo and banner for the stores support language English and Dansk we need some think like and better ...opencart 2.0 full support and mobile phone whit out any code errors templates for online fashion stores. + Design a Logo and banner for the stores support language English and Dansk we need some think like and better look like : 1: 2: 3: We are open to all suggestions only answer me if you are 100% can do this this is 3 time i am sending this project to many mails still no one can make this 100%

Hey, Can you please estimate your best price for SEO on my homepage. 1. My homepage: We work with personal finance and bookkeeping. 2. Key Words/ discription •Personal finance: Keywords: privatøkonomi, uvildig rådgivning, gæld, økonomisk rådgivning Discription: rådgivning om gæld, økonomisk rådgivning til private og virksomheder •Bookkeeping Keywords: bogføring, regnskab, skat, moms Discription: bogføring til billig fast pris, selvangivelse og moms, 3. Competitors •Personal finance: 1. 2. 3. •Bookkeeping: 1. 2. 3. If you need any other information, do not hesitate to contact me. Best regards Wasim R.

fdfd fef sdfr sdfr grsdfvd rhwr gdg er gdv drt gtdvcg dhdfvcgf rd gdcg rgftgdrg fthftg dg dthg fthf hfyhft

Patterson Dental Eaglesoft database extraction - Patterson Dental Eaglesoft database extraction - Patterson Dental Eaglesoft database extraction - Patterson Dental Eaglesoft database extraction

html5 css khjjfd dlkfldkf d lkdlfkd fdfdlkf dfkdlfkdlkf k;jglfh bvlfhbl fl;bh lhvks vk vhsvhls vl slgs;g;s

89888765goldenbirds5646546465hgvtftfyddddrddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddd

Programiranje za SQL i Android: molim vas vaš kontakt da se čujemo na telefon xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

a dialer for my asterisk box kasdjlasjdlasjdlasjdlasjdalsdjalsdjalskjdalskjdalskjdalksjdalskjdalskjdlksajdlasjdalsjdalsjdalsjdalsjalskjd 100chars

project for asferbert............................................................................................................................................................................................................................

hi, i just need somebody for a few hours working for my project, if i like it i have more work. beste regards. Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Aenean commodo ligula eget dolor. Aenean massa. Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus. Donec quam felis, ultricies nec, pellentesque eu, pretium quis, sem. Nulla consequat massa quis enim. Donec pede justo, fringilla vel, aliquet nec, vulputate eget, arcu. In enim justo, rhoncus ut, imperdiet a, venenatis vitae, justo. Nullam dictum felis eu pede mollis pretium. Integer tincidunt. Cras dapibus. Vivamus elementum semper nisi. Aenean vulputate eleifend tellus. Aenean leo ligula, porttitor eu, consequat vitae, eleifend ac, enim. Aliquam lorem ante, dapibus in, viverra quis, feugi...

...to work with you Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Aenean commodo ligula eget dolor. Aenean massa. Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus. Donec quam felis, ultricies nec, pellentesque eu, pretium quis, sem. Nulla consequat massa quis enim. Donec pede justo, fringilla vel, aliquet nec, vulputate eget, arcu. In enim justo, rhoncus ut, imperdiet a, venenatis vitae, justo. Nullam dictum felis eu pede mollis pretium. Integer tincidunt. Cras dapibus. Vivamus elementum semper nisi. Aenean vulputate eleifend tellus. Aenean leo ligula, porttitor eu, consequat vitae, eleifend ac, enim. Aliquam lorem ante, dapibus in, viverra quis, feugiat a, tellus. Phasellus viverra nulla ut metus varius laoreet. Quisque rutrum. Aenean imperd...

SharePoint 2013 Responsive Design Html 5 For government internet site SharePoint 2013 Responsive Design Html 5 For government internet site

edit a songxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

ddssvdddddfhfhdhjsakhdsakjhdsakhdjsköahdaskjhdsajhdsajkhdaksjhdsöhjdkajshdyaCDFUIVGHEFUBHVEUKRHBIOWUVYGWOIQUFWIVNGUQEHRPIUAFUHBIERUHHAEFEFVJHHJKFEHQFHRB BHIRRULGR

!!!!!!!!!!gjhggyug gujgjhguyfujgjhg yguyguyuuyg gjyguyg guyghgiug giuyghjbg ohugo giuygh ouighy oygo gougogo gougogyg gyugoig ogoy gyogog ogyb

...hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting aalborg hvad er et webhotel hvad er webhotel linux hosting open source webshop server hosting danmark start webshop virtual hosting vps hosting danmark web design wordpress theme webbureau webdesign webdesign cms webdesign aalborg webhotel webhotel billigt webhotel danmark webhotel gratis webhotel hosting webhotel priser webshop design webshop løsning webshop system webshop til salg website design using wordpress website design wordpress...

...hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting aalborg hvad er et webhotel hvad er webhotel linux hosting open source webshop server hosting danmark start webshop virtual hosting vps hosting danmark web design wordpress theme webbureau webdesign webdesign cms webdesign aalborg webhotel webhotel billigt webhotel danmark webhotel gratis webhotel hosting webhotel priser webshop design webshop løsning webshop system webshop til salg website design using wordpress website design wordpress...

this is work what i done. xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx xx x

gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

i want install ngenx mod ..........................................................................................................................................

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

fsdfsdddddddderterterrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrdddddddddddddddddddddddddddddddddd

Mit navn er Jonas og jeg er Webudvikler med mere end 7 års erfaring i branchen. * Primært fokus er Webudvikling (HTML/CSS, PHP, MySQL, JavaScript) * WordPress ekspert * Gennemtænkte løsninger, så du undgår unødvendig langtrukne projekter og ekstraarbejde * Kort leverings- og responstid (Haste opgaver er intet problem) * Kompetent rådgivning er vigtigere end øget salg (også selvom man er sælger)

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

NEED programmer ......................................................................00000000000000000000000000000000000000000000000000

jeanpierrejesses09 skype add me thanks xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

I'm seeking a web developer with extensive experience in Custom HTML/CSS to create a new website. Please note that I have not yet defined the specific type of site, nor do I have a pre-existing design, so creativity and flexibility are key. The ideal freelancer for this project should have a strong portfolio of Custom HTML/CSS sites, be able to work independently to create a design, and be open to discussing and implementing changes as the project progresses.

I'm seeking an expert of mailserver logic to enhance the security of my mailserver. Focus on comprehensive protection against potential threats. Mailserver is MailEnable v.10.48 Standard Edition. Server is Windows 2019, access allowed via AnyDesk (or Teamviewer) only Everything works perfectly. SPF and DKIM implemented. Ideal Skills: - Extensive experience in mailserver security - Proficiency in setting up robust security measures - Ability to identify and mitigate potential vulnerabilities - Knowledge of the latest security trends and threats I need to implement external tools (possibly free, preferably “portable”) to improve security - implement IPBAN [Free software to block out attackers quickly and easily on Linux and Windows] - implement a script to fre...

I'm in need of a developer to create an Android app that comes with a web panel for admin control and moderation. The Android app's specific functionalities haven't been decided yet, so I am open to suggestions. Key Requirements: - Development of a user-friendly Android app. - Creation of a web panel for single admin control. - Implementation of moderation features within the web panel. Ideal Skills: - Proficiency in Android app development. - Experience with creating web admin panels. - Strong understanding of implementing control and moderation features. Preferred Experience: - Previous work on Android apps with web panels. - Demonstrated ability to develop secure and efficient control systems.

...The path of the CSV file will be passed to the Merging and Analysis Scripts, which will merge the data with the existing dataset (ready) and generate the final report. Report Page: Display the final report generated from the scan and merging process. Profile Page: Display user information and the network addresses that have been scanned. Your Tasks: * Develop the Backend to connect the frontend with the Python scripts. * Link each scan type (from 10 types) to its corresponding scanning script. * Pass the path of the CSV file generated from the scan to the Merging and Analysis Scripts. * Display the final report on the Report Page. * Ensure the system works smoothly from start to finish. Find a freelancer to do the above task. *Price is nego...

I need assistance with data entry, specifically with customer data sourced from our database. The ideal freelancer should have experience with: - Data entry - Handling customer data - Navigating databases Skills in working with SQL, NoSQL or Access would also be beneficial as they may be necessary for this project. Please note that the specific database type has not yet been confirmed.

...resemble a mall directory, indicating a location with a dot. The words should be altered to read "The Year of the place". Key Requirements: - Creative and sleek design that grabs attention - Use of bright and vibrant colors - Incorporation of both a directory map and large, highlighted text -The graphic needs to be 1920 x1080 only The goal is to make it clear that a viewer is in the right place. I'm open to innovative ideas that align with the specified style and color palette. The ideal candidate will have robust graphic design skills, a keen understanding of modern design aesthetics, and experience working with bold, large-scale designs. I would need this graphic in a PNG and SVG for printing. Thank you! I prefer to make sure it works with my system before I ...

ISSUE: I previously improved the fan performance in my PC by physically cleaning the fan. But it now displays a black screen due to suspected hardware issues. It works completely fine when connected to external monitor via HDMI to HDMI cable. This needs to be fixed so that private PC internal screen can also display in addition...repair in my toolbox and some knowledge and experience in fixing my PC hardware. I will also explain the troubleshooting I have previously done. Please help me to fix the problem outside of my main job working hours. Specifically I would like instructions for further troubleshooting. Also if spare parts are needed, please help me to purchase the parts. Afterwards, I would like a consolidated report in electronic format that describes how the problem...

...future projects that re-uses the app as a template). I am just an individual not a company so budget is very small. Required - prepare and optimize the app for integration into Google Play as a subscription-based app - prepare backend for subscription API logistics and integrate into the app (7 days free use, $ thereafter per month) - pull the LLM API out of the app and have the app securely access it remotely for security using Google services - prep the owner on use of the updated app and Google Play billing, how to update the app if needed, how to update the hidden LLM API if needed - add in graceful fail error messaging in case of API call problems - optimize text input and text output displays, with chatGpt-style responses (slow displaying text) - update text response dis...

We are seeking an experienced freelance developer to set up a build server on OVH. The server setup must be configured using the console with the provided SSH access. Additionally, you will need to document the process and provide a guide on how to use the build server effectively. Project Details: 1. Server Configuration: • Use public SSH for console access. • Server details: • Host: • Username: root • Password: • Port: 22 2. Tasks to be Completed: • Access the server via the console using SSH. • Configure the server to function as a build server. • Optimize the server for performance and security during the build process. 3. Documentation: • Provide step-by-step documentation on how the build server was...

I'm looking for an expert to implement an RFID system that integrates with Odoo 17 and provide comprehensive remote training. Key Components: - RFID System: Functions may include Inventory Management, Access Control, and Asset Tracking. - Odoo 17 Integration: Primarily with Sales and Purchasing, Warehouse Management, and Human Resources. - Remote Training: Both basic training for end users and advanced training for technical staff. Ideal Skills: - Proven experience with RFID system implementation. - Extensive knowledge of Odoo 17, particularly its Sales, Warehouse, and HR components. - Excellent remote training skills, with the ability to explain complex technical concepts in an accessible way.

...العربية تحدثًا وكتابةً. مهارات تنظيمية: مهارات تنظيمية عالية مع القدرة على إدارة الوقت بفاعلية. العمل عن بُعد: خبرة سابقة في العمل عن بُعد وامتلاك أدوات العمل اللازمة. Remote Accountant Needed We are looking for a qualified accountant to work remotely, with the following qualifications: Responsibilities: Account Management: Record daily financial transactions and prepare financial reports. Report Preparation: Prepare monthly and annual reports and analyze financial results. Budget Management: Create and monitor budgets, ensuring compliance. Account Reconciliation: Perform monthly and annual account reconciliations. Audit Support: Collaborate with auditors and organize required documentation. Odoo Utilization: Use the Odoo system for managing financial and accounting operation...

I need an expert in power pages. YOU MUST HAVE EVIDENCE YOU CAN DO THE JOB OR DONT APPLY AS YOU WILL BE IMMEDIATELY REJECTED. Please supply proof with your submission. DONT SUBMIT WITHOUT EVIDENCE OF ...Background We have 50 different locations. Some locations are owned by more than client so lets say we have 40 clients We have reports for each location which need to see individually We need to see rolled up accounts per client We need all client reports rolled up in to a single report for us to have an overarching dashboard Data is in excel and we need it transferred to power BI and a power app. The power app platform will be logged in by each client and, like active directory, they will be able to see the report relevant to them. We need to prevent clients seeing othe...

Frontend Technologies : UNITY Backend Technologies: MYSQL,PYTHON List of Hardware / Sensor / Processor (if Project on Embedded System) : VR MASK Concept with Techniques 1. Main Lobby: * Design a 3D lobby environment using Unity, incorporating navigation elements like buttons or portals to access different therapy rooms. * Implement Unity's UI system to display user interface elements such as menus, progress bars, and tooltips. * Use Unity's scene management to load and unload different scenes seamlessly as users navigate through the lobby. 2. Nature Retreats (Nature Rooms): * Create immersive nature environments using Unity's terrain system, asset store, or procedural generation techniques. * Utilize lighting effects and particle ...

I'm looking for an expert to set up Podman on my Linux and MacOS systems. The setup should allow read and write access to a specific project directory on my host's file system. This is primarily for development purposes. Key Requirements: - Extensive experience and knowledge of Podman - Proficiency in Linux and MacOS - Ability to configure read/write access to a project-specific directory - Previous experience with container setup for development What I'm trying to do: I have a container running a Python app with UV and it needs to monitor a specified path for file changes (watchdog library) which is mounted into the container. Currently, the container can write to the volume but it doesn't detect if I drop a file into the folder. Please include any re...

I'm looking to set up a Shopify dropshipping store, focusing on Electronics and Gadgets. This project involves not just the technical setup, but also the creation of a unique brand identity and logo for the store. Key Requirements: - The store should include product reviews feature. - A keen sense for des...should include product reviews feature. - A keen sense for designing a store that is both appealing and user-friendly. - Experience in creating Shopify stores, ideally with a focus on dropshipping. - A portfolio that includes brand identity and logo design. The ideal freelancer for this project will be able to integrate my specific requirements with their own creative ideas and expertise. I am open to suggestions on how to make the store stand out in the competitive elec...

I'm looking for a talented video editor to help me edit my travel vlogs. The editing style should be simple and clean, ensuring that the focus remains on the stunning visuals and the narrative of my travels. Ideal Skill...video editor to help me edit my travel vlogs. The editing style should be simple and clean, ensuring that the focus remains on the stunning visuals and the narrative of my travels. Ideal Skills: - Proficiency in video editing software - Experience with travel-related content - Strong understanding of a 'simple and clean' editing style Please note, the choice of editing software is flexible as I'm open to editors who use Premiere Pro, Final Cut Pro, or DaVinci Resolve. If you have a portfolio of similar work, I'd love to check it out....

I am seeking a highly skilled developer to create a platform similar to SEMrush, with a primary focus on backlink tracking. This platform should be develop...capabilities. Key Features: - Backlink Tracking: The platform's main function will be monitoring and analyzing backlinks. Ideal Skills: - Expertise in Python, other technology with a strong focus on AI implementation. - Previous experience in developing SEO tools or similar platforms. - Strong understanding of backlink tracking and its importance in SEO. - Experience in implementing role-based access control systems. Please note that while the backlink tracking feature does not need to integrate with external data sources, the ability to do so may be advantageous. Your creativity and expertise in this area will be high...

I'm seeking an experienced graphic designer for developing a minimalist logo and tailored custom illustrations. The scope of the p...and tailored custom illustrations. The scope of the project involves: - Crafting a unique, minimalist logo - Creating custom illustrations to complement the brand The ideal candidate should have: - Proven experience in logo and branding design - A strong portfolio of minimalist designs - Excellent skills in creating custom illustrations As a detail-oriented and creative professional, I value open communication and a collaborative approach. I am looking for a designer who can understand and translate our brand’s vision into impactful visual elements. Ultimately, I am aiming for a cohesive, professional brand identity that resonates with o...

Development of an Online Ordering Platform for Cafés and Restaurants I am looking to develop an innovative platform for cafés and restaurants that allows customers to access a digital menu by scanning a QR code placed on their table. The platform will enable seamless order placement and payment, with features designed for both customers and restaurant staff. Main Features: Customer Interface: Scan a QR code on the table to access the digital menu. Place orders directly through the platform. Option to make secure payments online. Restaurant Management Dashboard: Receive real-time notifications for orders by table (e.g., “Table 5 has placed an order”). Manage orders, update order statuses (e.g., in preparation, delivered, etc.). Track payments and ...

My WordPress site on an Apache server redirects to an external .html page, but it's showing a 404 error instead of loading the page. This .html page contains downloadable files and is located outside of WordPress, directly on the server. The problem seems related to the .htaccess file. We need someone to: - Modify existing rules in the .htaccess file to allow access to the .html page. - Check file permissions for the .html page to ensure they are set correctly. I want to maintain the current permalink structure and ensure that non-permalink pages, like the .html page, are accessible without being redirected to a 404 error. Ideal candidates for this project should: - Have experience in managing and configuring WordPress on Apache servers. - Be proficient in .htaccess file m...

...investigate and recover critical data related to a legal case. This involves accessing and analyzing call records, WhatsApp conversations, and other digital communication data without direct access to the involved devices. The recovered data must adhere to strict confidentiality and legal standards. Key Responsibilities: - Use advanced forensic tools and techniques to recover communication records. - Analyze telecommunications systems for potential evidence, including call logs and message metadata. - Reconstruct deleted or hidden data from WhatsApp or other messaging platforms. - Provide a detailed forensic report with timestamps, recovered data, and actionable insights. - Ensure data integrity and legal admissibility for future use in investigations or court proceedings...

I need an urgent redesign of a section of our website. We are using AI to generated personalised reports for students that sit our question bank platform. Please see current attached screenshots of the design. I need this to be redesigned so the page looks better. To see how it looks, please visit: Username: tyrone (at the rate of)@ Pass: Password01! Then go to: Exaks> Click on the first 1 and click on Result. I need this to be done within the next 2-3 hours. Budget $30.

I'm looking for a talented web app developer (no agencies please) to help build multiple internal tools to streamline our workflow. We need a comprehensiv...agencies please) to help build multiple internal tools to streamline our workflow. We need a comprehensive Visitor Management system, alongside tools for Customer and Field Team Management. Key Requirements: - Develop a Visitor Management tool with features including: - Visitor check-in - Badge printing - Visit reports - Create other management tools as needed - Integrate with third-party or open-source CRMs for data collection and tracking Ideal Skills: - Proficiency in web app development - Experience with CRM integration - Ability to automate tasks within a company I would like to connect and discuss my requirem...

...payments, and having options for driver monitoring and blocking. All interfaces should enable detail modifications and include features for payment collection per trip, with options for credit settlement. The app must be: - Multilingual: Supporting English, French, and Hebrew. - Responsive and Multi-platform: Compatible with iOS, Android, and Web. I require original code with no copying, using only open libraries for free use. The bid should include a full price quote with project stages and a support period. Ideal candidates should have: - Proven experience in app development, particularly in the taxi industry. - Proficiency in creating multi-platform, responsive applications. - Strong understanding and ability to implement multilingual features. - Knowledge of, and experien...