Secretary of state vehicle registrationJobs
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq"...com","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You ca...
...available online but no plagiarism. Make sure site looks all good, fresh, up to date technologies, using Logo, QR code for appointment scheduler, patient registration, and test results automatically sent to Dr, patient and country email. The sites also accepts major credit and debit cards for people who do not have insurance. The site should be full integrated with well known LIS and LIMS systems like QBench and other well known systems. The site should be simple and intuitive but very productive and scalable. Only designer/web authors who have vast experience in setting up sites for testing labs should contact me. Need it ASAP Examples of sites https://www.freelancer.com/users/l.php?url=https:%2F%%2Fcovid19%2F%3Fgclid%3DCjwKCAiAlrSPBhBaEi
DataForce er en verdensomspændende dataindsamlings-og mærkningsplatform, der kombinerer teknologi med et mangfoldigt netværk af mere end en million databidragsydere, forskere og ingeniører. DataForce tilbyder virksomheder inden for teknologi, bilindustrien, biovidenskab og andre industrier, sikre og pålidelige KI-tjenester med henblik på exceptionelle, st...igangværende og fremtidige betalte undersøgelser. Alle kan deltage. Vores projekter kan foregå hjemme eller på et af DataForces kontorer. Få en yderligere indtægt ved at være bidragsyder: Alle undersøgelser er betalte, og deres varighed varierer fra få minutter til få timer. Interesseret? Klik på nedenstående link for at f...
View the video and pay attention at the 30 second mark. The 3D animated teeth brushing is what I need. Can you replicate that? Must be located in the USA, preferably Texas. When you respond, reveal the state you're located in. USA ONLY.
This is an ongoing project and most likely it will turn into a long term business relationship if things play out accordingly. MUST have: Python Selenium/Scrapy Django/Flask HTML/CSS/Boostrap JS MySQL, Postgres, Sqlite Redis, mongodb AWS, Heroku GIT + zenhub TDD, SOLID Nice to have: -React/Redux -CI, CD -Graphql -Elastic search Please show your past experience in your proposal PD: state what passions you about working as a freelancer in less than 10 words. all details will be provided to the few selected throu DM. Best Regards!!
Hi I need a reliable assistant/secretary to cut and paste data from websites into new contacts in Hubspot. You will get a list of links to companies like this one Your task is to extract the data and enter them into Hubspot. I am not sure how long it will take, so let's do it on an hourly basis. Please state your fee per hour. Please also write if you have experience with Hubspot. You will need a fast and stable internet connection. I look forward to working with you! Take care Erik
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
...semester is an interdisciplinary project. It combines distributed systems design, computer science and computer networks. PDA based flexible ticket system You are going to implement a prototype of a flexible ticket system. In its complete version it is going to replace the current RF-id tag based system. The new system expected lifetime is 5 year only. In 5 years it is expected that face recognition has advanced sufficiently to allow ticketing based entirely on automatic unattended image processing. While the proposed system only partly reduces the manual control, it will reduce the amount of sign in /sign out equipment on platforms and placing that equipment entirely in the rolling stock. Each train compartment or bus is already equipped with a wireless LAN c...
...semester is an interdisciplinary project. It combines distributed systems design, computer science and computer networks. PDA based flexible ticket system You are going to implement a prototype of a flexible ticket system. In its complete version it is going to replace the current RF-id tag based system. The new system expected lifetime is 5 year only. In 5 years it is expected that face recognition has advanced sufficiently to allow ticketing based entirely on automatic unattended image processing. While the proposed system only partly reduces the manual control, it will reduce the amount of sign in /sign out equipment on platforms and placing that equipment entirely in the rolling stock. Each train compartment or bus is already equipped with a wireless LAN c...
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I'm looking for a creative logo designer who can com...dinosaur Wearing a school cap and carrying a backpack Holding flying papers ✔ Vehicle: A vibrant, neon-style monster truck Large blue wheels with orange rims ✔ Text: "SCHULKIND" in bold, uppercase, repeated multiple times in blue The text should form a strong background pattern Overall Style: Bold, neon, high-contrast, fun, and playful cartoon-style illustration Bright and vibrant colors with thick outlines Deliverables: ✅ High-resolution PNG & JPEG files Skills and Experience: - Proven graphic design and logo design experience - Strong illustration skills, particularly in designing for children - Ability to create catchy, engaging designs that appeal to a young audience - A portfolio that demonstrates a v...
Position: Frontend Engineer Location: Remote (Eastern Time, USA) Type: Project-based Description: We are seeking a highly skilled Frontend Engineer with a strong understanding of Node.js and its ecosystem, including tools like npm and webpack. The ideal candidate will have extensive experience and qualifications in the following areas: API Integration: Familiarity with RESTful services. Frontend Frameworks: Knowledge of modern frontend frameworks, state management (Vuex, etc.), and frontend best practices. Responsive Design: Understanding of responsive design and cross-browser compatibility. Responsibilities: Develop clean, maintainable, and reusable code for frontend components using Vue.js and Nuxt.js. Build and integrate with backend services through REST...
I'm looking for a data vendor who can provide a list of homeowners in Los Angeles, California, who have expressed interest in home improvement within the last two weeks. The list should include: - Name and contact details - Property details - Type of home improvement needed - List phone numbers for quick contact. Please deliver the list in an Excel spreadsheet. Ideal candidates for this project should have experience in data collection and analysis. They should be able to provide accurate, up-to-date information in a timely manner. Knowledge of the home improvement sector would be a plus.
I'm seeking a skilled writer experienced in crafting personal goal statements specifically for a master's program in Nurse Practitioner Psychiatry. Key Require...experienced in crafting personal goal statements specifically for a master's program in Nurse Practitioner Psychiatry. Key Requirements: - Proven experience in academic writing, particularly personal goal statements. - Understanding of nursing and mental health fields. - Ability to articulate individual motivations and goals compellingly. Expected Deliverables: 1. Discuss why I want to pursue Nurse Practitioner Psychiatry specialty. 2. Describe how my past/current work experience will enhance my experience in this program. 3. State my goals/plans upon completion of the degree concerning the N...
My iPhone appears to be compromised. I need a professional to conduct a thorough check and restore my phone to its original state. Issues I'm Experiencing: - Unusual battery drain - Strange pop-ups or ads - Unauthorized access to accounts - Pictures being shared without proof Steps I've Already Taken: - Device reset - Anti-malware scan - Updated to the latest iOS Freelancers with experience in cybersecurity, particularly with iPhones, would be ideal for this project. Please include in your bid details of your experience with similar projects, and any strategies you would employ to resolve my issue. Thank you.
We are inviting experienced software developers or development teams to create a sophisticated online marketplace platform dedicated to the trading of digital products using advanced security and payment solutions, including cryptocurrencies. Technical Requirements: Programming Language: PHP Database: MySQL Consideration of using a modern framework such as Laravel or Symfony Development to be conducted in phases with payments tied to milestone approvals. Core Features: - Product listing functionalities with categories and advanced search capabilities. - User profiles with rating and review systems to foster a reliable community. - A secure transaction mechanism that includes an escrow system to protect both buyers and sellers. - Automated updates to user wallets when tran...
...health registered nursing. I want to emphasize my personal motivation and goals throughout the essay. Key Requirements: - Proven experience in academic writing, particularly personal goal statements. - Understanding of nursing and mental health fields. - Ability to articulate personal motivations and goals compellingly. Essay which includes the three following points: 1) Discuss why you want to pursue NURSE PRACTITIONER PSYCHIATRY 2) Describe how your past and/or current work experience will enhance your experience in this program 3) State your goals/plans upon completion of the degree. (The goals statement should be specific to NURSE PRACTITIONER PSYCHIATRY which is my specific choice program) (I've been an RN since 2021currently worked in a hospital on a ...
I'm looking for a skilled developer to help with a few tasks on my website. The tasks are as follows: Website URL - Tasks: 1. Change the "Sign Up" form requirements to only have "Username" "Password" "Email adress". 2. Implement Email Verification for User Sign-Up: Integrate an email verification system into the user registration flow. After users sign up, they should receive a verification email to activate their account before accessing the site. 3. Pop-Up "Sign In" Form on Button Click: Modify the "Sign In" functionality on the following page When the "Sign In" button is clicked, I’d like the sign-in form to appear as a pop-up/modal on the same page without navigating away. 4. Add Confirmatio...
End User Interface User auth Login with email and password Signup Name Email Address Phone numb...a design (pattern) All devices Profile Contact the admin via email to update the profile Not Editable Name Email Address Phone number Device setup Connect to the device through Bluetooth Wifi Connectivity Device registration Admin User interface Can create/delete user Name Email Address Phone number Add an installer Name Email Phone number Address Provioson a new device: Model number Mac address User email address Setup device 4 - Zones Bulb settings IC name color sequence - RGB, BGR, etc Assign a device to the user. Approve the device Every user must have a user number. Date of installation/creation for device Voice recognition (can be seen under third-party integration in th...
...colleges and promote this competition to students pursuing NEET. The exam price is 299, and you will earn a commission of 50rs for each student you successfully onboard. Ideal Skills: - Proven experience in education sector sales - Excellent communication and networking skills - Ability to engage and convince students What We Offer: - Competitive commission-based salary - Opportunity to work on a nationwide scale - Contribute to a significant event in the education sector The onboarding process for students is entirely online. So, your role will primarily be to facilitate their registration and encourage participation. Please note, this project is targeting students in all corners of India, not just urban areas. So, your reach and efforts in rural areas will al...
With the earlier design you did with the optlife logo there is a new version we would like. Same grapical objects, adding a few and then adding a new text. Sketch is done, same colors, objects and so as the last one. Some small creativity parts to add a cabin and an simple siluette of a mountain. The cabin should pop from the rest of the logo
...group status befitting purely voluntary attitudal enrichment of tangential parties at will only. This system is to comprise multiple connected parties and requires a harmonious coordination of validation points among each interrelation of participants' managerial arenas. Key Responsibilities: - Monitor and help to maintain group participants' personal holding of shared attitudinal components. - Oversee local administration of resources pooled among all agreed participating parties. - Coordinate handling of validation points in a harmonious manner. The primary goal of this role is enhancing voluntary organically emerging collaboration among all participants. Please note that all funds sent will be utilized solely for the admini...
...and I do the negotiation with the drivers. • Find and shortlist 10-12 drivers who are available and meet my requirements. • Deliver a list of driver options with names, contact details, pricing, and vehicle details. Trip Details: • Start Location: Penang • Route: Penang → Kuala Lumpur → Johor Bahru • Duration: Saturday to Tuesday (4 days) • Budget: Looking for the cheapest options available. • Language: English is NOT a must if the price is right. Ideal Driver Requirements: • Must have a car in good condition. • Full-day availability for driving. • Should be familiar with the routes between Penang, Kuala Lumpur, and Johor Bahru. Deliverables: 1. List of 10-12 drivers with: • Name & Contact Detai...
...looking for a freelancer who can create four minimalistic Lottie animations of a credit card being inserted, swiped, and tapped into a pinpad. The idea is to have three separate lotties for each interaction (1. card insert 2. card swipe 3. card tap and the fourth is a reel of previous three (card insert -> fade out -> card swipe -> fade out -> card tap -> fade out -> restart) The animations should be from the user's perspective, and they should adhere to a corporate color scheme which is already provided on the images. The images provided are a starting point but could be improved for a better appearance The idea is to show this animation on the payment pinpad to clarify to the user the three different kind of interactions they could have...
I'm looking for a professio...custom-built subdomain to the main domain via cPanel. This is intended to set up a dedicated vendors section on my website. Key Features of the Vendors Section: - Vendor Registration: I need a seamless and user-friendly registration process for vendors. - Vendor Product Listings: This section should allow vendors to list their products easily. - Vendor Sales Reports: An interface for vendors to track their sales. - Communication Bridge: The integration should facilitate smooth communication between the main domain and the subdomain. Ideal Skills and Experience: - Proficiency in cPanel and domain integration - Experience with custom-built subdomain platforms - Knowledge of eCommerce vendor systems - Excellent problem-solving ...
...Integration: - Integrate LiveKit into the website to enable automated text updates. - Implement API interactions and configure agents to work seamlessly with the existing backend. 2. Frontend Adaptation: - Update the Test Tab in `` to include a call interface: - Ensure the mic icon initiates calls and reflects an active state (e.g., changes color or transforms into an "end call" icon). - Display real-time streaming text of conversations in the designated area during calls. 3. Backend Implementation: - Write server-side logic in Node.js to interact with LiveKit's API. - Ensure data is fetched, updated, and stored efficiently in the PostgreSQL database[1][4]. 4. Testing and Debugging: - Validate the call interface functionality ...
? Website Development for Desktop Application Sales ? Website Structure 1️⃣ Homepage Product slides showcasing the desktop application. Links to social media platforms. Clear explanation of the benefits and features. Call-to-action (CTA) buttons directing users to registration and payment. Note: I have a sample website as a reference. 2️⃣ Registration and Login Area Allow users to create an account with email and password. Implement secure authentication (bcrypt for password hashing). Email validation upon registration. 3️⃣ Payment Area Integration with secure payment gateways (Mercado Pago, Stripe, or PayPal). Option to purchase a 30-day license for application usage. After payment confirmation, the system must automatically generate a login and password for ...
