Rate per page typingJobs
I need a web-page where clients can get legal advice. The web-page needs to be alike of the following: The web-page needs to be of a good quality and has to have the option to upload documents and payment has to be done through the web-page.
Jeg skal bruge en person der godt kan lide at skrive, og som skriver relativ nemt med mindre stavefejl. Jeg skal bruge nogen, der kan skrive mindre blogindlæg til noget SEO arbejde. Mindre stavefejl og manglende kommaer er fint. Du vil få et tema og en vejledende overskrift, som skal indarbejdes i teksten. Der er disse krav til hver indlæg: - Minimum 450 ord (Plejer at være ca. 0,75 side - 1,5 side i word) - Skal være emnerelevant - To specifikke ord skal indarbejdes i teksten (ordene kommer til at indeholde et link) Det var stort set det. Hvis man er okay skarp til hurtig at undersøge emnet, og skrive uden større fejl i første omgang, så burde et indlæg kunne skrives på 30 min eller mindre. Man må gerne tage insp...
Page speed for my website is so bad: I need this fixed. Plugins and website have to run the same way (unless we agree on disable).
I have an invoice template, i need to add a second page to it that have instead of the columns Beskrivning Antal Enhet à pris Moms Moms kr Belopp should have 10 columns. I have attached the invoice template. So i need a second description page to this template.
hej alle, er ved at designe et ur der skal lanceres på kickstarter og indsamle penge til produktion - i den forbindelse har jeg brug for en professionel landing page der kan indsamle email adresser på leadpages og videresende til mailchimp forbindelse med at promovere uret og sprede interessen inden kampagnen starter.
I need landingpage for my website that is based on Cake PHP. Landingpages similar to this:
Database description Database to be run on Internet, with a small number of users, now 6 users. Login for each user, the database is not visible if you are not logged in. The database to be used for the creation and search of records. The information consists of standard personal data, address, and mail. Typing the postcode, the city name is found in an underlying base. Furthermore, there is the creation date / correction date 3 text fields and 2 dropdown field - and a note field. One drop down box shows the default login person (which is part of the drop down option) Searching is done on 3-4 fields individually, and results are displayed as list, which can be clicked on, as each result is displayed. The layout may be edit via CSS. The database must be a SQL database. Th...
Design A Catalog Of Products (1 Page)
Phase 2 for Project #2 - Edit/Create Details Page. Using ReactJS C#
$1 per eBook Cover Want 10 Covers Let's bid
$1 per eBook Cover Want 50 Covers Let's bid
Details Per Discussion
(On-Page + Off-Page + Content Writing) for
Hej. Ser din profil her. Vi er et team, der er ved at udvikle på en nyheds-service, og vi sidder lidt fast på nogle af front-end design tingene. Jeg er på udkig efter nogle friske øjne på opstillingen af et par underside. Kunne du have mod på at kigge på det? Jeg tænker at starte med nogle få timer, så vi lige kan prøve hinanden an. Det kan så udvikle sig til meget mere - vi har en del forskelligt. Flair for godt user flow + responsive er must. Ser frem til dit svar. Sebastian
i need programmer build : - Affiliate System - Page Builder - Admin Panel - User Panel
html5 css khjjfd dlkfldkf d lkdlfkd fdfdlkf dfkdlfkdlkf k;jglfh bvlfhbl fl;bh lhvks vk vhsvhls vl slgs;g;s
html5 css khjjfd dlkfldkf d lkdlfkd fdfdlkf dfkdlfkdlkf k;jglfh bvlfhbl fl;bh lhvks vk vhsvhls vl slgs;g;s
Hej Jeg søger en free lancer til følgende opgave: 1) Hjemmeside (design og indhold finder vi ud af i fællesskab) 2) Login (må kun bestå af bestemte bogstaver) 3) Inde på siden skal der kunne uploades dokumenter (word eller pdf) 4) Det skal være nemt for andre brugere at finde frem til ovenstående dokumenter 5) Brugere skal kunne downloade dokumenterne 6) Brugere skal kunne rate dokumenter (f.eks. stjerner fra 1-5) 7) Dokumenter skal kunne sorteres via forskellige filtre (årstal, forfatter, navn etc.) 8) Der skal være toplister over bedst ratede dokumenter i hver "filter"/tema 9) Hver bruger skal have begrænset plads til at gemme dokumenterne tilknyttet deres personlige database. 10) Bruger skal ...
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
OYe Harami I Need Facebook Likes 8k Jaldi De Dena :D
Facebook Marketing Professionals to obtain more facebook page likes xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' Integrate javascript into html page'
We need to have the 2024 Rate card converted to an Excel sheet. They have discounted rates by 12.5% for Platinum Winter and 15% for Gold Winter, as shown in a column.
I'm in need of a dedicated personal assistant who can help me with daily task planning and building my LinkedIn profile. The ideal candidate will have excellent organizational skills and a knack for networking. Key Responsibilities: - Daily Task Planning: Help me prioritize and manage my daily tasks effectively. - LinkedIn Profile Building: Assist in enhancing ...approach people. - Someone who’s genuine, trust worthy & pays attention. - Someone who’s active and is always there and who cares. This role is perfect for someone who is proactive, has excellent communication skills, and understands the importance of building genuine relationships in a professional context. Prior experience with LinkedIn and task management is a plus. Budget : $2 per hour 8 hours...
I'm seeking a professional frontend dev...Furthermore, the platform needs to incorporate a rating and reviewing system for learners to share their experiences. Key Features: - Hosting of diverse online classes: The platform should be able to host classes on academic subjects, professional skills, and hobbies, including languages, math, chemistry, etc. - Learner Interaction: The platform should incorporate a robust system for learners to rate and review attended classes - User Friendly Interface: The design should be intuitive, engaging, and accessible for all age groups and skill levels. Ideal Skills: - Proficiency in frontend development languages (HTML, CSS, JavaScript, etc.) - Experience in designing user-friendly interfaces - Understanding of creating platforms with inter...
Such as add Square small website changed and only pay a small fixed rate do not bid lower then your willing to work for.
I'm looking for a talented web developer who can bring my design to life with Nuxt or VueJS (typescript) and GSAP ...design to life with Nuxt or VueJS (typescript) and GSAP for an animated, visually captivating service showcase landing page. Key Responsibilities: - Implement the design of the landing page - Create an animated hero section that captures attention - Develop clear, engaging service overview sections Ideal Skills and Experience: - Proficient in GSAP and web development - Experience with implementing designs into functional web pages - Understands how to create engaging, user-friendly interfaces - Able to work from a provided design - Proficient with Nuxt/Vue with Typescript Please reach out if you have the necessary skills and experience to create this ...
Vær venlig at Tilmelde dig eller Log ind for at se detaljer.
I'm in search of a talented web developer to create a comprehensive, multi-page website for my import-export consulting business. Main Sections: - About Us: This should detail our mission, vision, and team. - Services: A breakdown of the various consulting services we offer in the import-export domain. - Contact Us: This will include a simple form for inquiries, alongside our business contact details. Ideal Skills and Experience: - Proficient in web development languages (HTML, CSS, JavaScript, etc.) - Experienced in creating multi-page websites. - Able to design user-friendly and informative web layouts. - Familiar with import-export business terminologies and trends is a plus.
...Amazon). I will run their ad for one month at a time and set the price at a flat rate for the month, not per click or per sale. (Note that they can pay me manually via the payment link already provided on my site). Ideally, I want this ad spot to be something that I can manually change whenever I want to in order to generate a new ad for each writer who pays me for a month of display. IE: For instance, IF I can provide the URL of the site/page they want the ad to click through to, the ad will automatically change when that URL is entered into the ad space management panel. I will want the ad to include an image of their book and text with some sort of headline, similar to what they have displayed on the page/book they are promoting. Key Requirements:...
...Familiarity with website development, online payment systems, and POS systems. Great communicator and skilled at keeping others on task. Resourceful with research and able to present clear recommendations. Scope & Budget: Scope: Ongoing, with a focus on the gym setup and other key projects in the first few months. Estimated Hours: 15–20 hours per week to start, with the potential to scale up. Budget: Open to proposals (please specify your hourly rate or fixed-price options). Preferences: Experience Level: Intermediate to Advanced. Location: Can work in CST time zone....
I need a Windows-compatible desktop software designed for managing customer data and assessing customer risk. The software should include: - Data Entry and Storage: The software should allow for easy input and organization of customer data. - Customer Risk Assessment: The software must have a functionality to evaluate and rate customer risk. - Reporting and Analytics: The software should be capable of generating reports and providing analytics based on the stored customer data and risk assessments. Ideal skills and experience for this job would include software development for Windows desktop applications, experience in creating data management software, and knowledge in risk assessment algorithms.
I'm looking for a comprehensive web-based platform that can analyze and rank YouTube videos based on various metrics. I want the platform to focus on: - Analyzing and ranking videos based on metrics - Utilizing key metrics such as view count, engagement rate (likes, comments, shares), and watch time for the ranking process - Allowing me to select specific channels or videos that will be included in the ranking This project requires an experienced web developer with skills in data analytics and familiarity with YouTube's API. The ideal candidate will have a proven track record of creating similar platforms.
I'm in need of a dedicated freelancer for online typing tasks. Key Responsibilities: - Typing of plain text provided to you. - Following a specific format or template I will provide. The ideal candidate for this project should have: - Excellent typing skills with attention to detail. - Proficiency in following provided templates and formats. - Ability to work independently and meet deadlines. This is a great opportunity for someone looking to work from home on typing jobs.
I'm looking for a data entry specialist to collect email addresses from a specific website. The site has 480 pages, and ther...for a data entry specialist to collect email addresses from a specific website. The site has 480 pages, and there are 10 companies per page. What You Need to Do: - Navigate through the 480 pages and 10 companies per page. - Collect email addresses and input them into an Excel file. - Format: One email per cell. Ideal Skills and Experience: - Proficient in Excel. - Good attention to detail. - Previous experience in data collection or web scraping is a bonus. Please note, I only require the email addresses, not any additional information.
I'm looking for a professional who can create a permanent Wikipedia page for a person based on the information I will provide. This person has a noteworthy biography, a remarkable career, numerous achievements and awards, and substantial media and press coverage. Key Responsibilities: - Create a Wikipedia page that meets all of Wikipedia's guidelines for notability, verifiability, and neutrality. - Use the provided information about the person's biography, career, achievements, and media coverage. - Reliably source information from multiple independent sources to verify the information. Ideal Skills and Experience: - Previous experience in creating and publishing Wikipedia pages. - Strong understanding of Wikipedia's guidelines and standards. - Excellen...
