Positive impact of technology on societyJobs

Filtrér

Mine seneste søgninger
Filtrer ved:
Budget
til
til
til
Slags
Færdigheder
Sprog
    Job-status
    2,000 positive impact of technology on society jobs fundet
    €701 Gns Bud
    1 bud

    Hello everyone Who Can find expired domains for these websites

    €17 Average bid
    €17 Gns Bud
    4 bud

    Hey We have a very simple video tracking project. Please read everything before you apply for this! The file i have attached is a screenshot of a video, just to show what i am talking about! What i need you to do. - Link to download the video file: - I would like you to change the name on the town sign. (ex. Instead of Aarhus as the screenshot. Make it "Charlottenlund") - The list of names we would like you to make: (Only town names, not the numbers) 1. Charlottenlund 2. Kastrup 3. Odense 4. Sønderborg 5. Kolding 6. Randers 7. Frederikshavn 8. Holstebro 9. Esbjerg 10. Roskilde 11. Næstved

    €145 Average bid
    €145 Gns Bud
    7 bud

    In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq"...com","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You ca...

    €41 Average bid
    €41 Gns Bud
    12 bud

    Hired developer will be tasked with developing a scaleable, non-server-based Solana metaplex NFT marketplace minting engine and website that is capable of handling 10,000+ visitors at once. Must be compatible with Solana based cryptocurrency wallets. A design example that I like is: Info on such a site that I'm looking for could be found here: @elysianft/lets-put-an-end-to-bad-drops-on-solana-c8cfd6d33e69#id_token=

    €589 Average bid
    €589 Gns Bud
    5 bud
    €7 - €18
    0 bud

    Programmable timer unit with web UI for commercial application, such as school, factory etc. Hardware is ready. Only requires Firmware programmer in C ++ and with embedded web technology for user interface, to set or program the unit

    €2952 Average bid
    €2952 Gns Bud
    13 bud

    The creation of a virtual office

    €160 Average bid
    €160 Gns Bud
    4 bud

    Midtrans payment integration.

    €108 Average bid
    €108 Gns Bud
    55 bud

    We are looking for someone who can change so we will use for live chat at

    €23 Average bid
    €23 Gns Bud
    7 bud

    ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish

    €197 Average bid
    €197 Gns Bud
    4 bud

    Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid

    €149 Average bid
    €149 Gns Bud
    5 bud

    Logo designing

    €73 Average bid
    €73 Gns Bud
    21 bud
    €12 / hr Gns Bud
    4 bud
    Build of models
    Udløbet left

    Autocad designing

    €274 Average bid
    €274 Gns Bud
    6 bud

    Vi søger en som kan lave nogle gode videoer (ca. 2-3 minutter) til vores kommende youtube account. Det skal være professionelle gode videoer som repræsenterer firmaet og i hvert video skal der enten vises en bestemt destination, hotelkæde eller lignende. det er vigtigt at farverne samt logo og design af vores eget materiale og koncept afspejler i videoen. Hvis du laver et godt arbejde for os vil vi bruge dig op til flere gange hver måned.

    €129 Average bid
    €129 Gns Bud
    5 bud

    COPY OF AN ECOMMERCE SITE NEED My budget 30 usd

    €28 Average bid
    €28 Gns Bud
    2 bud

    Design A Catalog Of Products (1 Page)

    €18 Average bid
    €18 Gns Bud
    12 bud

    Jeg har vedblivende arbejde relateret til vores tidligere projekt 'Adjusting 2 book covers and upload on Create space today'

    €73 / hr Average bid
    €73 / hr Gns Bud
    1 bud
    €29 - €29
    0 bud

    Internal server error on NGINX

    €49 Average bid
    €49 Gns Bud
    4 bud
    €44 Gns Bud
    1 bud
    CSS fixes on form
    Udløbet left

    For

    €39 / hr Average bid
    €39 / hr Gns Bud
    1 bud

    Small PHP/Java script fix on hover over

    €19 Average bid
    €19 Gns Bud
    12 bud

    (On-Page + Off-Page + Content Writing) for

    €165 Average bid
    €165 Gns Bud
    1 bud

    Vi skal have lavet en hjemmeside, hvor man skal kunne sælge/købe privat. Det vi har behov for er, at man som sælger skal kunne beskrive/indsætte billede af en varer, og dernæst modtage en tal/bogstavskode som hører med til teksten/billedet. Denne "sag" skal så kunne sendes til andre brugere, evt. via mail eller mobilnummer. Modtageren skal så kunne "godkende" "sagen. Ting der senere skal kunne tilføjes: Et betalingssystem, hvor modtagerens indbetaling skal blive opbevaret indtil, at modtageren godkender den modtaget sag+varer+godkendelse.

    €249 Average bid
    €249 Gns Bud
    4 bud

    /findtranscript/ error.. pls fix

    PHP
    €19 Average bid
    €19 Gns Bud
    17 bud

    poster for online posts 3 pictures Bold

    €21 Average bid
    €21 Gns Bud
    13 bud

    Hey, Can you please estimate your best price for SEO on my homepage. 1. My homepage: We work with personal finance and bookkeeping. 2. Key Words/ discription •Personal finance: Keywords: privatøkonomi, uvildig rådgivning, gæld, økonomisk rådgivning Discription: rådgivning om gæld, økonomisk rådgivning til private og virksomheder •Bookkeeping Keywords: bogføring, regnskab, skat, moms Discription: bogføring til billig fast pris, selvangivelse og moms, 3. Competitors •Personal finance: 1. 2. 3. •Bookkeeping: 1. 2. 3. If you need any other information, do not hesitate to contact me. Best regards Wasim R.

    €741 Average bid
    €741 Gns Bud
    1 bud

    blog posting like SEO,DESIGNING,SOCIAL MEDIA,TECHNOLOGY

    €419 Average bid
    €419 Gns Bud
    19 bud

    Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:

    €148 - €445
    €148 - €445
    0 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'

    €24 / hr Average bid
    €24 / hr Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €18 - €148
    €18 - €148
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud
    PROJECT OF TYPING
    Udløbet left

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud

    Tunne a linux server

    €146 - €146
    €146 - €146
    0 bud

    im looking for an estimate on creating a cad drawing of the ring that i uploaded

    €29 - €244
    €29 - €244
    0 bud

    OUR COMPANY IS LOOKING FOR SKILLED INTERNET POSTING EXPERTS WHO CAN POST ON USA CLASSIFIEDS SITE INTERESTED PERSONS SHOULD CONTACT US AS SOON AS POSSIBLE THROUGH OUR SKYPE WHICH IS [Removed by Freelancer.com Admin]

    €244 - €731
    €244 - €731
    0 bud

    As per skype conference

    €439 Average bid
    €439 Gns Bud
    1 bud

    Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...

    €390 Average bid
    €390 Gns Bud
    5 bud

    I'm looking for beginner-level candidates for a cold calling project to sell my gym protein product. The target market is national, so the callers should be able to communicate clearly and effectively in English. Key Responsibilities: - Cold calling to potential customers - Selling a ...Responsibilities: - Cold calling to potential customers - Selling a gym protein product Benefits: -Incentive Base Requirements: - Beginner level experience - National market understanding - Ability to follow a script I will provide a pre-written script that the candidates will follow. However, flexibility and adaptability are key as they may need to deviate from the script based on the conversation. Ideal candidates will have a positive attitude, resilience, and a desire to learn and...

    €9 Average bid
    €9 Gns Bud
    8 bud

    I'm looking for a developer to create a standalone Apple Watch app that allows users to navigate through the Quran using speech recognition technology. Key Features: - Voice navigation through the Quran: The app should be able to recognize a recitation and take you to the verses being recited allowing users to navigate through the Quran hands-free. Please note that the app does not need to support multiple languages - it will only include the Quran in Arabic. Ideal candidates for this project should have: - Extensive experience in developing Apple Watch apps - Expertise in implementing speech recognition technology I'm looking for a developer who can deliver a high-quality, user-friendly app that meets these requirements.

    €757 Average bid
    €757 Gns Bud
    22 bud

    I'm exploring the psychological impact of music on shoppers and would like to integrate a music system on my e-commerce website. Goals: - Increase time spent on site - Boost mood and satisfaction - Encourage higher purchase values - Ultimately, get more business The project involves selecting the appropriate type of music, creating a plan for its implementation, and potentially monitoring its impact over time. Ideal Skills & Experience: - Knowledge in music psychology - E-commerce website development experience - Data analysis skills to assess impact - Creativity in music selection and integration please let me know how much at first

    €18 Average bid
    €18 Gns Bud
    16 bud