Open source flash physics game engine pushbuttonJobs
fdfd fef sdfr sdfr grsdfvd rhwr gdg er gdv drt gtdvcg dhdfvcgf rd gdcg rgftgdrg fthftg dg dthg fthf hfyhft
Patterson Dental Eaglesoft database extraction - Patterson Dental Eaglesoft database extraction - Patterson Dental Eaglesoft database extraction - Patterson Dental Eaglesoft database extraction
html5 css khjjfd dlkfldkf d lkdlfkd fdfdlkf dfkdlfkdlkf k;jglfh bvlfhbl fl;bh lhvks vk vhsvhls vl slgs;g;s
FAS FEdgdvd gf ef FAS FEdgdvd gf ef FAS FEdgdvd gf ef FAS FEdgdvd gf ef FAS FEdgdvd gf ef FAS FEdgdvd gf ef FAS FEdgdvd gf ef FAS FEdgdvd gf ef FAS FEdgdvd gf ef FAS FEdgdvd gf ef FAS FEdgdvd gf ef
89888765goldenbirds5646546465hgvtftfyddddrddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddd
Programiranje za SQL i Android: molim vas vaš kontakt da se čujemo na telefon xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
a dialer for my asterisk box kasdjlasjdlasjdlasjdlasjdalsdjalsdjalskjdalskjdalskjdalksjdalskjdalskjdlksajdlasjdalsjdalsjdalsjdalsjalskjd 100chars
hi, i just need somebody for a few hours working for my project, if i like it i have more work. beste regards. Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Aenean commodo ligula eget dolor. Aenean massa. Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus. Donec quam felis, ultricies nec, pellentesque eu, pretium quis, sem. Nulla consequat massa quis enim. Donec pede justo, fringilla vel, aliquet nec, vulputate eget, arcu. In enim justo, rhoncus ut, imperdiet a, venenatis vitae, justo. Nullam dictum felis eu pede mollis pretium. Integer tincidunt. Cras dapibus. Vivamus elementum semper nisi. Aenean vulputate eleifend tellus. Aenean leo ligula, porttitor eu, consequat vitae, eleifend ac, enim. Aliquam lorem ante, dapibus in, viverra quis, feugi...
...to work with you Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Aenean commodo ligula eget dolor. Aenean massa. Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus. Donec quam felis, ultricies nec, pellentesque eu, pretium quis, sem. Nulla consequat massa quis enim. Donec pede justo, fringilla vel, aliquet nec, vulputate eget, arcu. In enim justo, rhoncus ut, imperdiet a, venenatis vitae, justo. Nullam dictum felis eu pede mollis pretium. Integer tincidunt. Cras dapibus. Vivamus elementum semper nisi. Aenean vulputate eleifend tellus. Aenean leo ligula, porttitor eu, consequat vitae, eleifend ac, enim. Aliquam lorem ante, dapibus in, viverra quis, feugiat a, tellus. Phasellus viverra nulla ut metus varius laoreet. Quisque rutrum. Aenean imperd...
SharePoint 2013 Responsive Design Html 5 For government internet site SharePoint 2013 Responsive Design Html 5 For government internet site
edit a songxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ddssvdddddfhfhdhjsakhdsakjhdsakhdjsköahdaskjhdsajhdsajkhdaksjhdsöhjdkajshdyaCDFUIVGHEFUBHVEUKRHBIOWUVYGWOIQUFWIVNGUQEHRPIUAFUHBIERUHHAEFEFVJHHJKFEHQFHRB BHIRRULGR
!!!!!!!!!!gjhggyug gujgjhguyfujgjhg yguyguyuuyg gjyguyg guyghgiug giuyghjbg ohugo giuygh ouighy oygo gougogo gougogyg gyugoig ogoy gyogog ogyb
...hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting aalborg hvad er et webhotel hvad er webhotel linux hosting open source webshop server hosting danmark start webshop virtual hosting vps hosting danmark web design wordpress theme webbureau webdesign webdesign cms webdesign aalborg webhotel webhotel billigt webhotel danmark webhotel gratis webhotel hosting webhotel priser webshop design webshop løsning webshop system webshop til salg website design using wordpress website design wo...
...hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting aalborg hvad er et webhotel hvad er webhotel linux hosting open source webshop server hosting danmark start webshop virtual hosting vps hosting danmark web design wordpress theme webbureau webdesign webdesign cms webdesign aalborg webhotel webhotel billigt webhotel danmark webhotel gratis webhotel hosting webhotel priser webshop design webshop løsning webshop system webshop til salg website design using wordpress website design wo...
MOLOFO game, dette er et beta program som skal bruges til at generere et spil.
MOLOFO game, dette er et beta program som skal bruges til at generere et spil.
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
i want install ngenx mod ..........................................................................................................................................
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
fsdfsdddddddderterterrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrdddddddddddddddddddddddddddddddddd
Mit navn er Jonas og jeg er Webudvikler med mere end 7 års erfaring i branchen. * Primært fokus er Webudvikling (HTML/CSS, PHP, MySQL, JavaScript) * WordPress ekspert * Gennemtænkte løsninger, så du undgår unødvendig langtrukne projekter og ekstraarbejde * Kort leverings- og responstid (Haste opgaver er intet problem) * Kompetent rådgivning er vigtigere end øget salg (også selvom man er sælger)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NEED programmer ......................................................................00000000000000000000000000000000000000000000000000
jeanpierrejesses09 skype add me thanks xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' Need front and back design for card game'
Vi har brug for en online flashapplikation, hvor brugeren kan vælge mellem 5 hvide produkter, f.eks. en T-shirt eller en kop, mfl. Det skal herefter være muligt at udføre følgende funktioner: - Male på produktet med forskellige farver - vælge forskelliige tykkelser af brushes - Zoome ud og ind - Skrive tekster på produktet - vælge fonte og farver til teksten - Slette eller F...Male på produktet med forskellige farver - vælge forskelliige tykkelser af brushes - Zoome ud og ind - Skrive tekster på produktet - vælge fonte og farver til teksten - Slette eller Flytte tekster og malerier rundt og ændre lag rækkefølgen - og endelig skal det være muligt at gemme sit design som en jpg/png...
ACLS is privately owned construction and logistic company with its offices in United States, Arab Emirates and Afghanistan. The Company has been responsible for the design and construction of some of the most significant projects in Afghanistan. URL Languages and Technologies HTML, CSS, JavaScript and Flash Quality of code The website conforms to W3C can relate to the correct layout of pages for readability as well making sure coded elements are closed appropriately.
I'm seeking an SEO expert to improve my website's search engine ranking specifically on Google. My business operates in the Engineering HVAC sector, and the target regions for this project include the UAE, Saudi Arabia, Qatar, Oman, Bahrain, Iraq, Kuwait, Iran, Egypt, Algeria, Tunisia, Morocco, the USA, the UK, and Europe. Key Objectives: - Optimize for 50 strategically chosen keywords - Acquire 10,000 quality backlinks Skills & Experience: - Proven track record in SEO - Extensive experience with Google ranking - Familiarity with Engineering HVAC industry is a plus - Proficient in backlinking strategies I am looking for someone who can deliver 100% results. Please provide examples of your previous work and the results achieved.
I have a functioning React Native (WebView) Android application, where every aspect works perfectly, except for the Razorpay payment gateway. The issue is that the Razorpay popup window does not open at all. I am reaching out for an expert in React Native and Razorpay integration to help resolve this issue. - You should have proven experience of integrating Razorpay's official SDK into React Native webview applications. - The ability to troubleshoot and fix the popup issue promptly is crucial. Please bid if you can help solve this problem. Thank you!
I am seeking a skilled game developer with a strong portfolio in mobile games, particularly in the hyper casual genre. The game will primarily utilize tap as its control mechanism. Ideal Skills and Experience: - Proven experience in mobile game development - Strong understanding of hyper casual game mechanics - Proficiency in designing intuitive tap-based controls - Creative mindset with ability to develop engaging, simple yet addictive gameplay.
I'm looking for a professional with proven experience in Joomla and SEO to enhance the search engine ranking of my website. Key Requirements: - Implement on-page SEO techniques across all pages of the site - Utilize a pre-provided list of target keywords effectively Ideal Skills: - Expertise in Joomla - Proficiency in SEO strategies - Experience in improving search engine rankings - Ability to work with provided content and keywords
I'm looking for an expert who can help me create a comprehensive strategy for a lead generation campaign. The primary goal of the project is to generate leads and ultimately ...campaign should be professional yet approachable, striking a balance that appeals to a broad audience. Deliverables - A detailed strategy document outlining the campaign's different components. - Suggested content for various platforms, tailored to engage the target audience. - Key performance indicators to measure the success of the campaign. Additional Notes - I have a flexible budget and am open to investing in this project to ensure its success. - I would appreciate timely updates and communication throughout the process. Please feel free to reach out if you need more information or clarific...
I'm seeking an experienced developer specialized in creating 2D pixel art fighting games for PC and Console. Ke...art for the game's visuals. - Strong knowledge in cross-platform compatibility for PC and Console. - Ability to create engaging and balanced gameplay mechanics typical of fighting games. Ideal Skills: - Proficiency in game development engines, particularly ones supporting 2D and pixel art (e.g. Unity, Godot). - Previous experience with developing fighting games is highly preferred. - Strong understanding of pixel art aesthetics and ability to implement them in a game development context. Below, I attached gameplay footage made with M.U.G.E.N. to showcase what I want the game to play like. I created my own 2D sprites, and I now need someone/ pe...
I'm looking for a modern and sleek rollup design for my real estate agency. The purpose of this rollup is to promote our agency during open houses, so it should be appealing and attention-grabbing for potential buyers. Key elements to include: - Prominent display of our agency logo and contact details The design should be clean, contemporary and professional, reflecting the modern and sleek style of our agency. It should not be overly cluttered, but rather use space in a way that is visually appealing and easy to read from a distance. Ideal skills and experience: - Graphic design, particularly in creating promotional materials - Experience in the real estate sector would be a plus - Strong understanding of modern design principles - Ability to create a design that aligns wi...
...need my link to open in the default mobile browser (Chrome, Safari etc). I believe this can be achieved by adding some special code inside the target page. I have found 3 types of solutions online for this but none of them are proper solutions: Solution 1 - Fake downloading a file on the page so the Instagram browser redirects the visitor to the native mobile browser. Here is how: Solution 2 - Using a URL scheme such as googlechrome://domain to redirect the URL request to the native mobile browser. Here is how: Solution 3 - Using JS to open a new tab or new
I'm looking for a qualified online teacher to instruct my high school students in science. The teacher should be proficient in Chemistry and Physics. Ideal Skills: - Expertise in Chemistry and Physics - Experience teaching high school level science - Strong online teaching skills - Ability to engage and motivate students
I'm looking for a professional who can design a rigid coupling for a diesel engine. The primary objective of this coupling is power transmission. Ideal Skills and Experience: - Expertise in coupling design, particularly for diesel engines. - Proficiency in mechanical engineering principles. - Prior experience with rigid coupling systems. - Understanding of power transmission mechanisms. - Knowledge of CAD software for design purposes. I need design in one of these file styles:STEP | STP | SLDPRT | STL | IPT | 3MF | 3DXML | PRT | SAT But I will be providing an example part so that you can develop a part Please check screeshot to view an example
I'm looking for a professional who can design a rigid coupling for a diesel engine. The primary objective of this coupling is power transmission. Ideal Skills and Experience: - Expertise in coupling design, particularly for diesel engines. - Proficiency in mechanical engineering principles. - Prior experience with rigid coupling systems. - Understanding of power transmission mechanisms. - Knowledge of CAD software for design purposes. I need design in one of these file styles:STEP | STP | SLDPRT | STL | IPT | 3MF | 3DXML | PRT | SAT But I will be providing an example part so that you can develop a part
I'm looking for an expert who can help me create a comprehensive strategy for a lead generation campaign. The primary goal of the project is to generate leads and ultimately ...campaign should be professional yet approachable, striking a balance that appeals to a broad audience. Deliverables - A detailed strategy document outlining the campaign's different components. - Suggested content for various platforms, tailored to engage the target audience. - Key performance indicators to measure the success of the campaign. Additional Notes - I have a flexible budget and am open to investing in this project to ensure its success. - I would appreciate timely updates and communication throughout the process. Please feel free to reach out if you need more information or clarific...
I'm looking for a marketing expert who can elevate my pet-focused website's visibility and drive online sales. Key Responsibilities: - Promote the website primarily through social media and search engines. - Target the general public with engaging and persuasive content. Ideal Skills and Experience: - Proven experience in e-com...marketing expert who can elevate my pet-focused website's visibility and drive online sales. Key Responsibilities: - Promote the website primarily through social media and search engines. - Target the general public with engaging and persuasive content. Ideal Skills and Experience: - Proven experience in e-commerce promotion and digital marketing. - Strong knowledge of social media and search engine marketing. - Passion or understanding...
I'm seeking a web developer experienced in e-commerce site creation. The website should cater to...include: - Customer reviews: I want my customers to have the opportunity to share their experiences and give feedback on products. - Product comparison: A feature that allows customers to compare different products side by side would be beneficial. - Wishlist: This should allow customers to save products for future consideration. We also want different price levels As for the e-commerce platform, I'm open to suggestions. I've considered Shopify, WooCommerce, and Magento, but I'm unsure which one would best suit my needs. Therefore, a developer with experience in these platforms would be ideal. They should be able to advise me on the best option based on the specifi...
I'm ...functionality using BLE or standard Bluetooth, and the integration of the CAN bus and other safety sensors. - Focus on all elements: The coding assistance required will cover every aspect of the project, from the integration of the CAN bus module to the configuration of the BLE/standard Bluetooth for remote unlock. - Safety sensors: The system will include a neutral safety switch, as well as monitoring for engine RPM, door status, and other relevant indicators. The ideal freelancer for this project should have: - Extensive experience with Arduino coding - Knowledge of BLE and standard Bluetooth configuration - Familiarity with CAN bus modules - Experience working with fingerprint modules and safety sensors I am looking for someone who can deliver high-quality work in a...
...steel of these items. Key Elements: - Incorporating my company logo into the design - Using images of Royal Prestige products like pots, pans, the blender or juicer - A design style that is elegant and sleek Important Information to Include: - My name and title - Contact information - Company address Design Preferences: - While I have no specific colors in mind for the background or text, I'm open to suggestions. The design should be sophisticated and professional, without being overly complicated or colorful. Ideal Skills: - Graphic design - Experience with business card design - Proficiency with modern design software - Ability to incorporate brand imagery into design This project is perfect for someone who can deliver a high-quality, professional design that reflect...
...plan for a modern, minimalist open-plan courtyard-style home. This project will involve tweaking our existing blueprint to better suit our needs and aesthetic preferences. Key Responsibilities: - Modify the current layout to create a more fluid and spacious flow throughout the home. - Add or remove rooms as necessary. - Design and incorporate a central courtyard within the house. - Revamp the living and dining areas, bedrooms, bathrooms, and kitchen/utilities to fit an open-plan design. Ideal Candidate: - Proven experience in residential architecture, particularly with modern, minimalist designs. - Demonstrated ability to modify existing floor plans. - Creative mindset with an ability to design unique features such as a courtyard. - Excellent understanding of open...
I'm looking for an expert to help me develop a web application that integrates RAG, Ollama, and Neo4j. I need to create a Demo of a RAG application with Neo4j or LangGraph. The idea is to ask open questions to the loaded document and show relationships between data using graphs. Synthetic data can be used but focused on Banking Ideal skills for this job: - Proficiency in web application development - Experience with data visualization tools and techniques - Knowledge of RAG and Neo4j - Familiarity with Ollama - Strong background in data analysis
Seeking a skilled SEO expert to improve my website's search engine ranking according to the latest Google guidelines. There are some issues flagged in Google Console that need addressing. Key Responsibilities: - Off-page SEO: Implement strategies to enhance the website's authority and visibility. - Technical SEO: Identify and rectify any technical issues affecting the website's performance. I have a specific list of keywords I'd like to target, so I won't need assistance with keyword research. However, I'm open to suggestions for optimizing their usage. Ideal Skills and Experience: - Proven track record in white hat SEO - Deep understanding of Google's guidelines and updates - Proficient in using Google Console for SEO analysis - Experi...
