Only data entry and typingJobs
...tiling shop and have the product page and ordering process similar to: or What's important: - Price entry in the backend should be in m² - We should display the price of m² and the price of a box with its contents. - The visitor will enter the surface he needs, it will be rounded up to the next number of boxes that cover that area. - Or he will enter the number of boxes and see how much that is in terms of area. - Both fields are interconnected. - Show the total cost of his order. I will give you more details via chat if needed. I am really looking for someone with good english who can understand the whole picture and do what's
Mere par believe Karo to mere taraf se koi sikayat nhi aaye ga please order Karo mujhe
Vi søger en professionel oversætter af en række tekster (ca. 4-6 tekster á 1-2 A4 siders længde) med fokus på sportsindustrien. Det er en forudsætning, at du skriver flydende dansk og kan tilpasse teksterne, så de er korrekt formuleret og du har en grundlæggende forståelse af indholdet, og er vant til at skrive artikler. Arbejdet kan enten aflønnes på timebasis eller med et fast honorar.
Hi Anvi V.. Pls hlp me how its work i need work i know data entry but yr ispe kse krna hai aur ksejob kre please help as a sister ...... plese mere ko pta nhi tha kse msz kru apko but yhi mere shi lga 9988882969 aap mere ko cll kr skteho is no p please sister help me
Lave noget arbejde i Excel Jeg har bruge for hjælp til at laver et system på excel over købesaftaler
Kopiere oplysninger fra nogle hjemmesider Transfer chess games from paper to it system
I need to get better traction in Denmark on the following keywords: bestil catering bestil selskabsmad bestil mad ud af huset catering mad ud af huset festmad bestil buffet My domain is:
Database to be run on Internet, with a small number of users, now 6 users. Login for each user, the database is not visible if you are not logged in. The database to be used for the creation and search of records. The information consists of standard personal data, address, and mail. Typing the postcode, the city name is found in an underlying base. Furthermore, there is the creation date / correction date 3 text fields and 2 dropdown field - and a note field. One drop down box shows the default login person (which is part of the drop down option) Searching is done on 3-4 fields individually, and results are displayed as list, which can be clicked on, as each result is displayed. The layout may be edit via CSS. The database must be...
I'm looking to have a smart TV app developed for LG and/or Samsung. THe app would be a simple web-browse player with HTML5 support which is able to display a website in Full Screen mode. No interaction required beyond the entry of the URL and storage. Would ideally like to have the option to have it automatically selected upon turning on the TV. Udvikling af en SmartTV app til LG og/eller Samsung. App er en en simple web-browser player med HTMl5 understøttelse som formår at vise en website i Fullscreen mode. Ingen interaktion påkrævet udover URL indtastning og lagring. Skal gerne kunne vælges automatisk ved tænding af TV. - dog ikke noget krav.
NECESITO AYUDA PARA MEJORAR MI RANKING EN WOORANK. MI WEB ES:
blog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta...
We offer 1$ per received SMS. We need 2 informations from you : 1) Is message arrived ? 2) How long did you wait for message ? We need freelancer only from this countries: PANAMA ARGENTINA AUSTRALIA BRAZIL COSTA RICA ESTONIA FINLAND FRANCE GREECE HONG KONG HUNGARY ICELAND IRELAND ISRAEL ITALY JAPAN KOREA, REPUBLIC OF LATVIA LITHUANIA LUXEMBOURG MALAYSIA MEXICO MOLDOVA, REPUBLIC OF MOROCCO NEW ZEALAND NORWAY POLAND PORTUGAL RUSSIAN FEDERATION Saudi Arabia SLOVAKIA SLOVENIA SWEDEN SWITZERLAND TAIWAN, PROVINCE OF CHINA THAILAND TURKEY URUGUAY We are testing our community software and we need testers. You need to be online on freelancer.com when we do that. Your mobile number must be from countries list above. Bid for this job : ...
word file & exal sheet entry bhgfhngfhngfngfngfjngfjgf
Hej, Jeg skal have skrevet 2 artikler, og søger derfor en dansker eller to til at skrive dem.
Data Entry for lalanvivek1991_S_Coords_6_8734983_ lalanvivek1991_all Data Entry for lalanvivek1991_S_Coords_6_8734983_ lalanvivek1991_all Data Entry for lalanvivek1991_S_Coords_6_8734983_ lalanvivek1991_all
Data Entry for dangersystem_S_Coords_2_90373362_dangersystem_First_1500 Data Entry for dangersystem_S_Coords_2_90373362_dangersystem_First_1500
Data Entry for bd100m_S_Coords_3_57638273_bd100m…t1500 Data Entry for bd100m_S_Coords_3_57638273_bd100m…t1500
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
secret project :) secret project :) secret project :) secret project :)
Data harvesting affdd gsfg hsdh sdgh hgh gjhh djdj h hdfjfd fj dfjhj jjf dgjddfdfd aas sf f aff adfd af df fdf fad f
data entry dsaadsdasd sdaddf dsf f fds fds fdsf dsfds dsf fd fds dsf dfs fds dfs fsd sdf sdf f s fdsf fds f
elf+ntn+digi+skl for Tyxla only elf+ntn+digi+skl for Tyxla only elf+ntn+digi+skl for Tyxla only elf+ntn+digi+skl for Tyxla only elf+ntn+digi+skl for Tyxla only elf+ntn+digi+skl for Tyxla only elf+ntn+digi+skl for Tyxla only