Only data entry and typingJobs

Filtrér

Mine seneste søgninger
Filtrer ved:
Budget
til
til
til
Slags
Færdigheder
Sprog
    Job-status
    2,000 only data entry and typing jobs fundet

    ...tiling shop and have the product page and ordering process similar to: or What's important: - Price entry in the backend should be in m² - We should display the price of m² and the price of a box with its contents. - The visitor will enter the surface he needs, it will be rounded up to the next number of boxes that cover that area. - Or he will enter the number of boxes and see how much that is in terms of area. - Both fields are interconnected. - Show the total cost of his order. I will give you more details via chat if needed. I am really looking for someone with good english who can understand the whole picture and do what's

    €297 Average bid
    €297 Gns Bud
    26 bud
    Data entry
    Udløbet left

    Mere par believe Karo to mere taraf se koi sikayat nhi aaye ga please order Karo mujhe

    €19 / hr Average bid
    €19 / hr Gns Bud
    40 bud

    Vi søger en professionel oversætter af en række tekster (ca. 4-6 tekster á 1-2 A4 siders længde) med fokus på sportsindustrien. Det er en forudsætning, at du skriver flydende dansk og kan tilpasse teksterne, så de er korrekt formuleret og du har en grundlæggende forståelse af indholdet, og er vant til at skrive artikler. Arbejdet kan enten aflønnes på timebasis eller med et fast honorar.

    €66 Average bid
    €66 Gns Bud
    18 bud
    €10 Gns Bud
    1 bud

    Web enten from mobil apps to text file

    €8 - €15 / hr
    €8 - €15 / hr
    0 bud
    Project for Anvi V.
    Udløbet left

    Hi Anvi V.. Pls hlp me how its work i need work i know data entry but yr ispe kse krna hai aur ksejob kre please help as a sister ...... plese mere ko pta nhi tha kse msz kru apko but yhi mere shi lga 9988882969 aap mere ko cll kr skteho is no p please sister help me

    €107 Average bid
    €107 Gns Bud
    1 bud
    data entry operator
    Udløbet left

    i have done this work in seven days

    €11 / hr Average bid
    €11 / hr Gns Bud
    24 bud

    I have a transleter data entry

    €18 / hr Average bid
    €18 / hr Gns Bud
    25 bud

    typing,designing

    €15 / hr Average bid
    €15 / hr Gns Bud
    1 bud
    Microsoft Typing
    Udløbet left

    Typer of Files in Microsoft Office

    €6 / hr Average bid
    €6 / hr Gns Bud
    129 bud
    Do some data entry
    Udløbet left

    Lave noget arbejde i Excel Jeg har bruge for hjælp til at laver et system på excel over købesaftaler

    €109 Average bid
    €109 Gns Bud
    15 bud
    data entry
    Udløbet left

    i have work

    €282 Average bid
    €282 Gns Bud
    22 bud

    i dont have

    €76 Average bid
    €76 Gns Bud
    22 bud
    Do some data entry
    Udløbet left

    Fylde data i et regneark

    €456 Average bid
    €456 Gns Bud
    7 bud
    Do some data entry
    Udløbet left

    Kopiere oplysninger fra nogle hjemmesider Transfer chess games from paper to it system

    €98 Average bid
    €98 Gns Bud
    4 bud

    I need to get better traction in Denmark on the following keywords: bestil catering bestil selskabsmad bestil mad ud af huset catering mad ud af huset festmad bestil buffet My domain is:

    €68 Average bid
    €68 Gns Bud
    28 bud

    Database to be run on Internet, with a small number of users, now 6 users. Login for each user, the database is not visible if you are not logged in. The database to be used for the creation and search of records. The information consists of standard personal data, address, and mail. Typing the postcode, the city name is found in an underlying base. Furthermore, there is the creation date / correction date 3 text fields and 2 dropdown field - and a note field. One drop down box shows the default login person (which is part of the drop down option) Searching is done on 3-4 fields individually, and results are displayed as list, which can be clicked on, as each result is displayed. The layout may be edit via CSS. The database must be...

    €266 Average bid
    Fremhævet Haster
    €266 Gns Bud
    9 bud

    Bookkeeping, Data Entry, QuickBooks

    €87 Average bid
    €87 Gns Bud
    8 bud

    Data entry for product details

    €123 Average bid
    €123 Gns Bud
    31 bud
    Byg en SmartTV app
    Udløbet left

    I'm looking to have a smart TV app developed for LG and/or Samsung. THe app would be a simple web-browse player with HTML5 support which is able to display a website in Full Screen mode. No interaction required beyond the entry of the URL and storage. Would ideally like to have the option to have it automatically selected upon turning on the TV. Udvikling af en SmartTV app til LG og/eller Samsung. App er en en simple web-browser player med HTMl5 understøttelse som formår at vise en website i Fullscreen mode. Ingen interaktion påkrævet udover URL indtastning og lagring. Skal gerne kunne vælges automatisk ved tænding af TV. - dog ikke noget krav.

    €854 Average bid
    €854 Gns Bud
    4 bud

    need freelancer for data entry

    €259 Average bid
    €259 Gns Bud
    36 bud

    NECESITO AYUDA PARA MEJORAR MI RANKING EN WOORANK. MI WEB ES:

    SEO
    €90 Average bid
    €90 Gns Bud
    4 bud
    Data Entry - Repost
    Udløbet left

    Bookkeeping, Data Entry

    €19 Average bid
    €19 Gns Bud
    1 bud
    blog and deta entry
    Udløbet left

    blog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta entryblog and deta...

    €146 Average bid
    €146 Gns Bud
    1 bud

    We offer 1$ per received SMS. We need 2 informations from you : 1) Is message arrived ? 2) How long did you wait for message ? We need freelancer only from this countries: PANAMA ARGENTINA AUSTRALIA BRAZIL COSTA RICA ESTONIA FINLAND FRANCE GREECE HONG KONG HUNGARY ICELAND IRELAND ISRAEL ITALY JAPAN KOREA, REPUBLIC OF LATVIA LITHUANIA LUXEMBOURG MALAYSIA MEXICO MOLDOVA, REPUBLIC OF MOROCCO NEW ZEALAND NORWAY POLAND PORTUGAL RUSSIAN FEDERATION Saudi Arabia SLOVAKIA SLOVENIA SWEDEN SWITZERLAND TAIWAN, PROVINCE OF CHINA THAILAND TURKEY URUGUAY We are testing our community software and we need testers. You need to be online on freelancer.com when we do that. Your mobile number must be from countries list above. Bid for this job : ...

    €23 Average bid
    €23 Gns Bud
    15 bud

    word file & exal sheet entry bhgfhngfhngfngfngfjngfjgf

    €18 - €148
    €18 - €148
    0 bud

    Typing jobs, Form filling etc.

    €137 Average bid
    €137 Gns Bud
    18 bud
    Do some Excel Work
    Udløbet left

    excel data entry id feeding online feeding

    €19 Average bid
    €19 Gns Bud
    9 bud
    DTP Job
    Udløbet left

    I Am DTP Operator Wedding Card, Visiting Card, Typing eng, mar, guj, hindi,

    €18 - €148
    €18 - €148
    0 bud

    Hej, Jeg skal have skrevet 2 artikler, og søger derfor en dansker eller to til at skrive dem.

    €41 Average bid
    €41 Gns Bud
    2 bud
    €10 - €29
    0 bud
    Data Entry
    Udløbet left

    I need details

    €22 Average bid
    €22 Gns Bud
    34 bud
    Data Entry -- 2
    Udløbet left

    Excel spreadsheet worj

    €8 Average bid
    €8 Gns Bud
    1 bud
    Data Entry
    Udløbet left

    Excel spreadsheet worj

    €15 Average bid
    €15 Gns Bud
    7 bud
    Data Entry
    Udløbet left

    Above budget monthly

    €280 Average bid
    €280 Gns Bud
    40 bud
    Data Entry -- 2
    Udløbet left

    Part time....

    €79 Average bid
    €79 Gns Bud
    2 bud
    Data Entry
    Udløbet left

    Typing , online form filling

    €10 - €29
    €10 - €29
    0 bud

    Data Entry for lalanvivek1991_S_Coords_6_8734983_ lalanvivek1991_all Data Entry for lalanvivek1991_S_Coords_6_8734983_ lalanvivek1991_all Data Entry for lalanvivek1991_S_Coords_6_8734983_ lalanvivek1991_all

    €45 Average bid
    €45 Gns Bud
    1 bud

    Data Entry for dangersystem_S_Coords_2_90373362_dangersystem_First_1500 Data Entry for dangersystem_S_Coords_2_90373362_dangersystem_First_1500

    €24 Average bid
    €24 Gns Bud
    1 bud

    Data Entry for bd100m_S_Coords_3_57638273_bd100m…t1500 Data Entry for bd100m_S_Coords_3_57638273_bd100m…t1500

    €19 Average bid
    €19 Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €18 - €148
    €18 - €148
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €69 Average bid
    €69 Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud
    PROJECT OF TYPING
    Udløbet left

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud

    secret project :) secret project :) secret project :) secret project :)

    €24 Average bid
    €24 Gns Bud
    1 bud
    Data entry-2
    Udløbet left

    Data harvesting affdd gsfg hsdh sdgh hgh gjhh djdj h hdfjfd fj dfjhj jjf dgjddfdfd aas sf f aff adfd af df fdf fad f

    €24 / hr Average bid
    €24 / hr Gns Bud
    1 bud
    data entry
    Udløbet left

    data entry dsaadsdasd sdaddf dsf f fds fds fdsf dsfds dsf fd fds dsf dfs fds dfs fsd sdf sdf f s fdsf fds f

    €2 / hr Average bid
    €2 / hr Gns Bud
    1 bud

    elf+ntn+digi+skl for Tyxla only elf+ntn+digi+skl for Tyxla only elf+ntn+digi+skl for Tyxla only elf+ntn+digi+skl for Tyxla only elf+ntn+digi+skl for Tyxla only elf+ntn+digi+skl for Tyxla only elf+ntn+digi+skl for Tyxla only

    €1945 Average bid
    €1945 Gns Bud
    1 bud
    Data Entry
    Udløbet left

    Data Entry Use 10 Finger.

    €233 Average bid
    €233 Gns Bud
    1 bud