New members of the seventyJobs

The specs for this project are Wordpress based / Editable in the backend of the site Fast in google page speed insights Goal is under 2 seconds on all pages WP rocket + CACHING + MINIMISE PICTURES Features Videos Picture slides Animation videos Editable text Editable pictures Editable blocks Editable logos Create unique URLS - SEO wise Design wishes 14 different logos containing the name of each “BRAND name” FIGMA only / UX optimizing just like on FIGMA project Requirements WORDPRESS BASED Able to connect up with our DIV - contact formular on - FROM OUR BACKEND DEVELOPER (RoR Ruby On Rails) It should always be possible to load external JS as the current one is based on, so I don't think they can make something that wo...

In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq":"0","channel":"main-w-chan51-8888-react_uzonmseebkkzidac-MRb2","channelHash":"17978758530268586595","boxName":"chan51-8888","baseHost":"","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyT...

...mig-consumiveis-acessorios/ How you can see the reference link, is much better to costumer choose what he needs. Some details: - pay attention on the picture with number, the costumer can choose what part he need and add directly to shooping cart - the list of parts showing, you can see: Position, Stock Code (I do not need this one), Product Name, Pack Qty( I do no need this one), Price, Quantity and Total - you can choose differents products and "add to Cart" with only one click. - I expect you code what I want using "Pages" and "Static Blocks" of magento 1.6. This must be replicable. TOGETHER WITH THE QUOTE, I WILL ANSWER ONLY WHO SEND ME A DESCRIPTION HOW YOU PLAN TO DO THE CODE BE WORKING I...

Hi I have a proposal

A new hosting company is arising from Scandinavia, and are looking for a Lead Designer who can control and engage in the Wordpress theme setup and functional design. The Website is supposed to be multilangual, by using WPML, and the control panel for the Hosting services is supposed to be build into Wordpress. For the sake of this, the designer will be required to think outside the box, and be able to work from a framework-thinking. The Wordpress tool WHMCS is not part of the project. Find ideas from:

We must have set up a new webshop like this here Webshop should have about 40 products, so it is a small webshop

Hej Satya - The Web Expert, Jeg lagde mærke til din profil, og vil gerne tilbyde dig et projekt. Vi kan diskutere detaljer over chat.

I wanna I have booking site. help me.

I want to create a wolf head logo

The creation of a virtual office

I have prepared 4 links and articles in the travel segment before December 29th. They must all be published before 29 December.

Hey Guys, I am looking for at person which can help me with 2 things. 1. Find a wocoommerce plugin which works like following: 2. Style the plugin to the design I got

We are looking for someone who can change so we will use for live chat at

ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish

I need to add the text to this movie. The text is as below: PLEASE ADD THE TEXT BELOW INTO THE BEGINNING OF THE VIDEO Nhà hàng Bonjour Vietnam, Copenhagen, Denmark trân trọng gửi tặng món quà bé nhỏ đến các gia đình có hoàn cảnh khó khăn tại Bệnh viện đa khoa tỉnh Hà Nam. THIS TEXT WILL RUN AFTER: Alvorligt syge mennesker i Vietnam, kan ikke regne med at få den slags hjælp, som vi mener er en selvfølge i Danmark. THEN THIS TEXT: Det kun er få år siden, vi selv levede under samme fattige kår, besluttede vi for nogle år siden, at donere en del af vores indtægt til syge mennesker på Ha Nam hosp&ari...

programmer

Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid

Logo designing

I have my campaign

Autocad designing

COPY OF AN ECOMMERCE SITE NEED My budget 30 usd

Team Agent is a teamfinding and team management website for eSport games (League of Legends and Counter-Strike Global Offensive) Demo site: Assignment: The site is almost done, but the last element need to be developed - which are: - Facebook sign up/sign in integration + API info (steam link & In game name) - Build a system that read the grabs from the game publicers API, the user profile of the gamer. - responsive design (mobile friendly) - Application requirements, which is where the teams can tell what kind of members they seek. Based on some dropdown criteria and text. The assignment will have to be done ASAP. We would be pleased to see you have experience with: Python 3+ Djan...

Jeg har vedblivende arbejde relateret til vores tidligere projekt 'iPad design for an APP - "the undertakers"'

Design A Catalog Of Products (1 Page)

Contact Ross to discuss confidential details.

12cm*22cm, 2 sides

Need Banner Designer for My Clients.

session singer

after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs..

best price project best price xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxx

"Mi Vida Es Un Desmadre" Shirt

3rd time deal!

Hi I own three sites: , & I need you to copy the template and content of from one webhotel to another, and upload it to roliga-skamt.se. Then, I need you to replace content and texts from with content and subpages from sjove-jokes.dk. In short, i need: 1. Copy site from to new webhotel (from to ) and upload to site 2. Replace content from Sjove-citater with content from sjove-jokes (less than 20 sub sites) 3. Create new header and a new simple logo for favicon 4. Same setup as with the mobile responsiveness Give me a fair offer. Best

Vi skal have lavet en hjemmeside, hvor man skal kunne sælge/købe privat. Det vi har behov for er, at man som sælger skal kunne beskrive/indsætte billede af en varer, og dernæst modtage en tal/bogstavskode som hører med til teksten/billedet. Denne "sag" skal så kunne sendes til andre brugere, evt. via mail eller mobilnummer. Modtageren skal så kunne "godkende" "sagen. Ting der senere skal kunne tilføjes: Et betalingssystem, hvor modtagerens indbetaling skal blive opbevaret indtil, at modtageren godkender den modtaget sag+varer+godkendelse.

/findtranscript/ error.. pls fix

poster for online posts 3 pictures Bold

Search for etc.

slider enhancements

Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:

ddd ddd ddd ddd ddd ddd ddd affasgsdfgsdgdsgsg

Need freelancer for Coolgen in Mainframe

Jeg har vedvarende arbejde relateret til vores tidligere projekt ' Move website to new domain. Same website host'

See your mail for details. Thanks

Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'

gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR