Logo design ideas for construction of buildingJobs
I am looking for a skilled freelancer who can create a script and video explainer for my product/service introduction. Requirements: - The purpose of the video explainer is to introduce my product/service to potential customers. - I do not have an existing script or narrative, but I have a rough idea of what I want to convey. - The video length required is 1 minute. Ideal Skills and Experience: - Strong scriptwriting skills to create a compelling and engaging script. - Experience in creating video explainers for product/service introductions. - Proficiency in video editing and animation software to bring the script to life. - Creativity and ability to turn rough ideas into a visually appealing and informative video. If you have the skills and...
Androidbuilder, mit app builder, kodular tools app building required
The specs for this project are Wordpress based / Editable in the backend of the site Fast in google page speed insights Goal is under 2 seconds on all pages WP rocket + CACHING + MINIMISE PICTURES Features Videos Picture slides Animation videos Editable text Editable pictures Editable blocks Editable logos Create unique URLS - SEO wise Design wishes 14 different logos containing the name of each “BRAND name” FIGMA only / UX optimizing just like on FIGMA project Requirements WORDPRESS BASED Able to connect up with our DIV - contact formular on - FROM OUR BACKEND DEVELOPER (RoR Ruby On Rails) It should always be possible to load external JS as the current one is based on, so I don't think they can make something that won't work with th...
I w...to have a website made for a local car dealer. Technical requirements: API - (more info in the document attached) Style-idea: Attached picture / Black&white theme (open for ideas) Text: Will be provided Prefferred CMS: Wordpress (Contents should be editable without complicated technical skills) Pages: maximum 10 pages Booking function: Book a test drive for one of the cars available Competitors for inspiration: Please don't provide me with a generic proposal. It will be ignored. Look through the competitors' sites, and read the documentation and provided attachments. Only bid on the project if it is possible for you to finish it
A new hosting company is arising from Scandinavia, and are looking for a Lead Designer who can control and engage in the Wordpress theme setup and functional design. The Website is supposed to be multilangual, by using WPML, and the control panel for the Hosting services is supposed to be build into Wordpress. For the sake of this, the designer will be required to think outside the box, and be able to work from a framework-thinking. The Wordpress tool WHMCS is not part of the project. Find ideas from:
I wa...to have a website made for a local car dealer. Technical requirements: API - (more info in the document attached) Style-idea: Attached picture / Black&white theme (open for ideas) Text: Will be provided Prefferred CMS: Wordpress (Contents should be editable without complicated technical skills) Pages: maximum 10 pages Booking function: Book a test drive for one of the cars available Competitors for inspiration: Please don't provide me with a generic proposal. It will be ignored. Look through the competitors' sites, and read the documentation and provided attachments. Only bid on the project if it is possible for you to finish.
...this, then the job is not for you. I would like to encourage females to place a bid. Skills count for more than gender in the end, though. But women ROCK! ;) I will need something visual and/or clickable since I do not speak "tech" at all. It's like reading Mandarin or Swahili to me. Must work in the WP theme Astra. I can't provide link just yet to the Astra theme, since the developer is unavailable for a few days. We can buy the PRO version if needed. Go to The site is in danish, but the functions will be more or less the same. The job is ONLY for the price calculator with the green slider input, some variables as add-on choices with a preset default value, and the price with an output. We need a slightly simpler version of...
I don't read autogenerated responses to my ad. So if you want to be considered in relation to this job, please give me a proper offer. I need help with link building. Links must be created to follow pages Keyword: meeting booking, meeting bookers, new customers Keyword: telemarketing Keyword: Sales manager, hire a sales manager, What can you offer? NoFollow and Folllow - PageRang!
I have a 2400 sqy agriculture land looking for ideas to build a farm house
The creation of a virtual office
help me build this website --> http://burgaardsjuletræ
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg sk...lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel De...
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
SEO SMO (FaceBook) Link Building Forum Posting Blog Posting
Link Building, SEO, Internet Marketing, Social Media Marketing, Market Research
...through manually link building, leads generation, social media marketing... The website is a architect company which targets Denmark area. On-page optimization has already been done. Only off-page SEO optimization is required to improve keyword ranking on Google. For anyone interested in this project, please submit a detailed proposal of how the keywords will be ranked and the techniques used. Full report of the work done must be submitted. All work has to be done manually using white-hat processes. -- Only white hat, experienced, highly ranked on freelancer.com SEO experts should bid -- Quality back links must relate to site topic on high quality relevant sites -- No black hat, gray hat or unethical SEO methods are to be used -- no junk pr...
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Internet marketing, SEO, Link Building, Facebook marketing
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
Dear Indyainfo i want you to work 8 hours on my site, make it more SEO powerfull. remember link building. I made a list wil a lot of keywords. i just want to be on page 1 at as many as possible if you can do that. Hope to hear from you soon. bedste danske web hosting bedste gratis hosting bedste hosting bedste web hosting bedste webhotel billig domæne hosting billig email hosting billig hosting billig server hosting billig web hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark ...
Dear Indyainfo i want you to work 8 hours on my site, make it more SEO powerfull. remember link building. I made a list wil a lot of keywords. i just want to be on page 1 at as many as possible if you can do that. Hope to hear from you soon. bedste danske web hosting bedste gratis hosting bedste hosting bedste web hosting bedste webhotel billig domæne hosting billig email hosting billig hosting billig server hosting billig web hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark ...
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
ACLS is privately owned construction and logistic company with its offices in United States, Arab Emirates and Afghanistan. The Company has been responsible for the design and construction of some of the most significant projects in Afghanistan. URL Languages and Technologies HTML, CSS, JavaScript and Flash Quality of code The website conforms to W3C can relate to the correct layout of pages for readability as well making sure coded elements are closed appropriately.
