List of common words in urdu and arabicJobs
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq":"0","channel":"main-w-chan51-8888-react_uzonmseebkkzidac-MRb2","channelHash":"17978758530268586595","boxName":"chan51-8888","baseHost":"","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersio...
I need a complete material list from drawings. The project is Ib polish.
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Hi, I am looking for a freelancer to hire for a big project regarding a book translation. Therefore I would like you to do a little translation sample for our customer before chosing the translator for this task. Total word count: 17.000 words. Estimated project start date: October Pleas find the short sample text to be translated here. Important: It does not have to be a 1:1 translation. Feel free to be creative and interpretative. "Åh jo, hvor har jeg haft mange gode oplevelser i klubben …. Dengang i 90´erne da jeg var yngre og slankere; nej måske var jeg ikke slankere, vægten var bare bedre fordelt, dengang var SLM et fristed. Man var fri for PANs larmende technohelvede, til tider intrigante miljø og ubehage...
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
Lebanese & Arabic Restaurant specialized in Charcoal grilling, home-made authentic cuisine, seafood with a bit of international light meals as vatieties of omellettes, pastas, cold & hot appetizers
Keyword list: 1. Hydrocortisone Spray for Dogs 2. Dog Heartworm Medicine 3. Dog Barrier for SUV 4. Tapeworm Medicine for Dogs 5. Belly Bands for Male Dogs 6. Dog Water Bowl No Spill 7. Dog Car Ramps 8. Hot Spot Treatment for Dogs 9. Automatic Dog Waterer 10. Dog Poop Scoopers Same spreadsheet, same steps
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
ok thank youxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ok thank youxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
...using our product "FURIKAKE". See attached for our products. Existing recipes are in our website. Variety of our FURIKAKE FURIKAKE youtube video Please find the detail description of "FURIKAKE" at the end of project description. Key Requirements: - Create one idea of recipe using FURIKAKE. (if more than one idea, appreciate) - Write the recipe - Take photo Procedure: 1) we will send you our FURIKAKE 2) create ideas of recipe and share with us 3) write one recipe 4) take photos Your role will create the new idea of using FURIKAKE. Our target customers are 10-20 ages of female/male living in USA. ******************************************************* "FURIKAKE" is Furikake
I'm in need of a skilled Siemens PLC Programmer, HMI and Panel designer to create a white and blue lighting control system for a hospital environment. This system will be implemented in various areas of the hospital including patient rooms, operating rooms, and hallways and common areas. Key Responsibilities: - Design and program a Siemens PLC based lighting control system. - Incorporate HMI and Panel design into the project. - Ensure the system is suitable for a healthcare environment. Ideal Skills and Experience: - Extensive experience with Siemens PLC programming. - Proven track record in HMI and Panel design. - Prior experience designing control systems for healthcare environments ...
I'm seeking a designer to create a modern and sleek logo for my men's nonprofit group, Lifters of Men. Key requirements for the logo include: - A modern yet assertive design style that conveys serving and brotherhood. - Black and white is good. - With or without Subtle Incorporation of visual elements of helping a friend into the design, symbolizing the group's focus on upliftment and strength. cleaner, sleeker. Ideal skills for this project: - Proficiency in graphic design software. - Creative thinking and ability to interpret concepts into visual symbols. - Experience in designing logos, particularly for nonprofit or male-oriented organizations.
...a (business) management challenge you have faced and 3-4 SPECIFIC strategies for addressing the challenge(s). (2000 words, APA reference style). I also provide key articles to be referenced and cited in the text. Feel free to choose the challenge, but I provide the strategies below: The strategies: Developing and implementing clear goals and objectives: This can help to ensure that everyone is on the same page and working towards the same goals. Communicating effectively with your team: This can help to build trust and rapport, and ensure that everyone is aware of what is expected of them. Delegating tasks effectively: This can help to free up your time to focus on more important tasks, an...
I'm seeking a talented Hindi Urdu lyricist who can craft lyrics for multiple genres including Romantic, Devotional, and Party/Upbeat songs. Key Responsibilities: - Write engaging and rhythmically sound lyrics across various genres. - Understand and implement appropriate song meter and rhythm. - Tailor lyrics to fit different moods and themes. Ideal Skills: - Proficient in Hindi and Urdu, with deep understanding of both languages' lyrical nuances. - Experienced in writing lyrics for diverse music genres. - Ability to understand and write according to song meter and rhythm. Please only post your bid if you have a portfolio in writing song lyrics and can demonstrate your unde...
I'm seeking a ...memory dump using Volatility 3. The primary goal of this analysis is to scrutinize user activity, with a particular focus on file access. I need you to pinpoint and report on the access of specific types of files, including documents, multimedia files, and executables. Ideal skills for this project include: - Extensive experience with forensic analysis and in-depth knowledge of Volatility 3. - Proficiency in identifying and interpreting user activity within a memory dump. - Ability to categorize and report on different types of accessed files. - Strong attention to detail and thoroughness in analysis. Your expertise will help me understand the user activity on this syst...
...Windows SmartScreen, antivirus software, and browsers like Chrome. Key Requirements: - Create a Windows-only .exe file for a game or entertainment software. - Implement all necessary Code Signing certificates, with a specific preference for Extended Validation (EV) Code Signing. - Develop a solution to avoid SmartScreen warnings immediately, particularly for Windows users. The ideal freelancer for this project should have extensive experience in software development, particularly in creating .exe files for games or entertainment software. A deep understanding of Code Signing certificates, especially EV Code Signing, is crucial. The candidate should also have a proven track record of developing software that gains immediate trust from Windows SmartScr...
Hide JavaScript and Load from an External Domain Project Overview: I am looking for a skilled web developer to help me implement a mechanism that hides a JavaScript file's source code from the browser and loads it from an external domain. The goal is to prevent the exposure of sensitive JavaScript code and improve security by offloading it to a secure external server. Project Requirements: JavaScript Obfuscation: The JavaScript file should be obfuscated or minified to make it harder to reverse-engineer. Use appropriate tools such as UglifyJS, Terser, or other obfuscation techniques. Load JavaScript from an External Domain: The JavaScript file should be loaded dynamically from a different domain, not directly from the origin domain. Set up cross-origin re...
...I need someone to create a 3d rendering of a storage facility to show at a Boat and RV convention. It is a pretty simple build. It is 1 giant building that is 560 feet long by 80 feet wide (44,800 sqft). On either side of the long side there will be 40 garage doors on each side that are 12 feet wide by 14 feet tall with one entry way door in the middle of both sides. On the 80 feet wide sides there will be two entry doors for people to enter through to get to their unit. Other than that, there will be 75 feet of concrete surrounding the entire building for RVs and Boats to move around on and on the east side of the facility we will gravel 40 parking spots that are 14 feet wide by 50 deep for outdoor parking. Then finally it ...
...mechanical plans signed and sealed by a Missouri Professional Engineer for the walk-in-cooler of the new liquor store. Wildwood Tobacco & Liquor 16437 Village Plaza View Dr, Wildwood, MO 63011 I already have the city of wildwood building permit and applied to st. Louis county. However, I have received the comment from st. Louis County for permit. Provide mechanical plans signed and sealed by a Missouri Professional Engineer. If no mechanical work is being done, then due to the change in occupancy classification the following shall be provided signed and sealed by a Missouri Professional Engineer: o Heat loss and gain calculations. o Ventilation calculations in compliance with 2015 IMC Section 403 and Tab...
...for a web designer to revamp my website layout. I prefer a modern and minimalist style, which is clean and easy to navigate. Ideal Skills: - Expertise in modern web design - Proficient in minimalist design principles - Experience with user-friendly layout creation -A great eye for detail -Common Sense -Easy and efficient english speaking and writing skills -Organizational skills We need a slight new makeover of our site. You will take our existing data and images and make a better page layout so that the whole site is uniform and looks trustworthy by other users. You are cosmetically fixing our site to look better. Fix the website to make it look good. Some images dont match the size of the other im...
I'm seeking a detail-oriented freelancer to manually upload 2000 products from a specified website onto another. The products span a mixture of categories including Electronics, Fashion, and Home Goods. Key Responsibilities: - Manually transferring product information including product descriptions and technical specifications - Ensuring all uploaded products are approved on the destination site Ideal Skills and Experience: - Previous experience with manual data entry and product uploads - Understanding of product descriptions and technical specifications - High attention to detail to ensure accuracy and compliance with site requirements
...piece for my business. The footer on each page should be the same. *Files are attached below of what we want included in this marketing option!!! We would like the professional to use a similar style that was used before but make it a little easier to read and navigate for our clients. We would also like to improve the documents overall visual appeal. The design style should be business professional but not boring. I have included the original document (pdf), a instruction and content document that contains the changes requested from the original document, our marketing guide and a couple extra logos. I would also like to have the ability to make future changes in a PDF so I would like a common font that comes with a standard adobe...
Hello, We have a file with about 4500 rows containing data of Italian associations, music, art and similar. The file contains the tax ID, name, address. We need to retrieve the email address and phone number if present. We will provide a list of 20 names to allow us to verify the results you can provide