Legal contracts bill of saleJobs
I am in need of webscraping services for Danish Law. Specifically, I would like the data to be scraped from Danish law websites. No translation is necessary as I plan to use the data in Danish. Additionally, I would prefer that the data be directly imported into a database for my use. If you have experience with Danish legal webscraping and are comfortable with this project, I am eager to work together to get this project accomplished. The deliverables are code, sub-domain URLs from three websites + the scraped content. The target web-sites are , and
I need a web-page where clients can get legal advice. The web-page needs to be alike of the following: The web-page needs to be of a good quality and has to have the option to upload documents and payment has to be done through the web-page.
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq"...com","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You ca...
For our company in denmark i need to have transfer pricing dokumentation made based on sale from our head office in denmark to a company we own in Norway. I need it asap.
I need 2 posers done, for selling kayaks. Color: 4+0 Size: 79 x 119 cm Must look like summer & sun - thats is what we are selling. POSTER 1 TEXT: Header: Kajakken som alle kan sejle H2: Perfekt til sommerhuset H3: Sæt dig ned i den, og sejl afsted H4: Bestil idag, og vi leverer uden beregning. POSTER 2 TEXT: Header:...we are selling. POSTER 1 TEXT: Header: Kajakken som alle kan sejle H2: Perfekt til sommerhuset H3: Sæt dig ned i den, og sejl afsted H4: Bestil idag, og vi leverer uden beregning. POSTER 2 TEXT: Header: Nem og stabil kajak H2: Til børn og voksne H3: Perfekt til sommerhuset H4: Bestil idag, og vi leverer uden beregning. I have uploaded some pictures for using. I have also uploaded a picture of the sign that the poster is for. F...
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
for sale EMAILS skype:
Whatsapp channels & active numbers for any country available for sale. I have full database of whatsapp for across the world. I can even filter any list of mobile numbers Whatsapp secure password protected channels are also available for sale
poster for online posts 3 pictures Bold
I need someone writing a number of good SEO quality articles for a new real estate website. For instants: "Are you looking for buying a new flat in London? Do you like to live in the middle of London? Do you wish to..." 1. Articel/blog about: "Flats for sale" 2. Articel/blog about: "Flats for rent" 3. Articel/blog about: "Student residence for rent" 4. Articel/blog about: "Residential rental" 5. Articel/blog about: "Property in London for rent" 6. Articel/blog about: "Property in London for sale" The size of each article should be like: "Lejlighed København Kunne du tænke dig at gå en tur på Langelinje om morgenen, shoppe i but...
I need someone writing a number of good SEO quality articles for a new real estate website. For instants: "Are you looking for buying a new flat in London? Do you like to live in the middle of London? Do you wish to..." 1. Articel/blog about: "Flats for sale" 2. Articel/blog about: "Flats for rent" 3. Articel/blog about: "Student residence for rent" 4. Articel/blog about: "Residential rental" 5. Articel/blog about: "Property in London for rent" 6. Articel/blog about: "Property in London for sale" The size of each article should be like: "Lejlighed København Kunne du tænke dig at gå en tur på Langelinje om morgenen, shoppe i but...
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I need assistance with converting and formatting my M&A documents from .pdf to Word. The documents should be fully formatted and ready for legal review. Skills in legal word processing, attention to detail, and experience with M&A documents are critical to the success of this project.
I'm looking for a modern digital artwork of Jesus as described in the Book of Revelations. The piece should depict Him with ''white hair as wool and eyes that look like flames of fire''. PLEASE USE THE PAINTING BY JOHN CAMPBELL...I would like to use the exact face but change the hair white wool and the eyes that look like flames of fire. **********Please look at the skin complection of image I posted by John Campbell. I prefer a brown skinned complection.***** the full Body picture is an great example of serene and peaceful. Emotional Tone: - The overall emotional tone of the artwork should be 'serene and peaceful'. Ideal Skills: - Modern digital art - Attention to detail - Ability to convey emotions...
...(OCs) as they enter a fantastical, enchanted forest. Key features of the project: - Style: The animation should be cartoonish, capturing a lighthearted and whimsical mood. - Setting: The fantasy realm is primarily an enchanted forest, so there should be plenty of vibrant, magical elements typical of such a setting. - Mood: The GIF should convey an exciting and adventurous journey, filled with playful twists and turns. - Specific Element: A 'Welcome to Astoria' banner or writing in the sky. This should be integrated into the scene in a creative way. Ideal Skills and Experience: - Proficiency in creating high-quality, engaging cartoonish animations. - Experience with creating GIFs suitable for this style. - Strong understanding of pacing, timing an...
I'm seeking an experienced designer to enhance my PowerPoint presentation. The main focus will be on improving the graphics and visuals. I have completed the pack and need it made more professional with some visuals and improved layout. Key Requirements: - Transform the presentation into a more corporate and formal style. - Utilize a preferred color scheme I will provide. - Suggestions for optimal design layout and visual elements. Ideal Skills: - Proficiency in PowerPoint and graphic design. - Expertise in creating corporate and formal presentations. - Ability to work with provided color schemes and design elements.
I need my training material translated and culturally localized from English to multiple Indian regional languages. The material is currently in PDF format and needs to be translated into Tamil, Bengali, Telegu, Kannada, Malayalam, and Hindi. Ideal skills and experience: - Proficiency in English and the target languages - Experience in translation and localization...culturally localized from English to multiple Indian regional languages. The material is currently in PDF format and needs to be translated into Tamil, Bengali, Telegu, Kannada, Malayalam, and Hindi. Ideal skills and experience: - Proficiency in English and the target languages - Experience in translation and localization - Familiarity with training material - PDF editing skills - Cultural understanding of the target...
Hi Motiur, I'd like to scrape a number of entries off of a webpage list of 232 different law firms. Most I'd like are shown on the primary page. If possible, I would also like to pull the description of the firm on the profile page linked to the primary page (I've called this the "clickthrough description" in the excel template). Do you think you can get all this information for the firms? Best, Will
...Listings: Clients can post a wide range of projects, from short-term tasks to large-scale contracts, which freelancers can browse and apply for. Secure Payments: The platform ensures secure transactions for both freelancers and clients, utilizing escrow services and milestone-based payments. Communication Tools: Built-in messaging and video call features help foster seamless communication between freelancers and clients. Support: 24/7 customer support is available to assist with any queries or issues during the collaboration process. Target Audience: This platform is ideal for freelancers, entrepreneurs, and business owners who are looking for specialized talent for short-term or long-term projects. It also serves as a reliable resource for clients in need of ...
...currently working on developing a new line of Prebiotic soft drinks for the European market. The concept is centered around creating fiber-rich beverages, similar in essence to brands like Olipop or Wildwonder, while adhering strictly to European regulations. I am reaching out to inquire if you would be interested in collaborating on this project. Specifically, I would like your assistance in developing recipes for four different soft drink products tailored to the European market. These drinks should be rich in fibers and meet all applicable legal and nutritional standards in the region. Could you kindly let me know: 1. If this is something you would be interested in working on. 2. The estimated cost for your services, including the development of recipes and e...
I'm looking for a talented artist to create a stunning, realistic watercolor portrait that portrays the love and pain of the world. - Style: The portrait should be in a realism style. - Medium: The artist should be skilled in using watercolor. - Subject: The central subject of the portrait will be multiple people, so the artist should be experienced in portraying human figures. The final piece should be able to attract a multitude of souls. Ideal candidates for this project should have a deep understanding of human emotions and experiences, and be able to translate that into their artwork.
...Multilingual Capabilities (if applicable): Skilled in transcribing content in [language(s)], ensuring cultural nuances and linguistic accuracy. Detail-Oriented: Exceptional attention to detail for formatting, grammar, and style consistency. Confidential and Secure: Guaranteed confidentiality for sensitive and private materials. Experience Across Industries: Familiar with transcription needs in legal, medical, academic, and business sectors. Tech-Savvy: Proficient with transcription tools like Express Scribe, , or [your tools], enhancing efficiency and precision. Flexible Work Style: Open to custom formatting, timestamping, and speaker identification as per client requirements. Strong Communication Skills: Easy collaboration, responsive to feedback, and committed to client s...
I'm looking for a web designer to create a professional and functional website for my legal services and consultations. The design should be similar to the example provided: www.miraklawfirm.com. Key Responsibilities: - Create a modern, user-friendly, and responsive website. - The designer should incorporate features that are typical for legal service websites. - Maintain a professional tone throughout the design. Ideal Skills: - Proven experience in web design, particularly for legal or consultation services. - Strong understanding of UX/UI principles. - Proficiency in modern web design tools and software. Please note, the specific style, key pages, and color preferences for the website have not been decided yet, and may be discussed further with the s...
...automatically. I belong to a large community of users who will use this tool. I have a bunch of other bigger projects which I'm looking for a dev for and this lotto project will potentially lead to regular work in an exciting, leading edge of blockchain development. I am looking for a long term-relationship with a quality dev to build amazing things. Key features of the application will include: - No user signup, the user only enters their chosen name for their entry to the lotto when sending their ticket purchase: The app will lock all of the users' ticket amounts into a smart contract with time lock and paid out at a specific time every week to a randomly chosen address. - Lottery ticket purchase: The app should facilitate easy and se...
...clients, including hotels, hospitals, factories, and other major businesses. - Promote and sell our range of premium paper products to meet the unique needs of these industries. - Build and maintain a robust pipeline of potential clients, negotiating contracts and closing deals. - Provide market insights to help refine and adapt our offerings for the U.S. market. - Represent TOTH GLOBAL SOLUTIONS with professionalism and a deep understanding of our brand values. What We’re Looking For: Proven Experience: Demonstrated success as a sales agent in the paper products industry, specifically with large-scale B2B clients. Industry Knowledge: Familiarity with the procurement processes and needs of target sectors in the U.S. market. Established...
