Importance of health care systemJobs
I m working in voip in Morocco from 2014 I have a system of asterisk Isabel the problem is when my client send me trafic give him an erreur 486 must be 503 In this case my client lost his traffic https://www.freelancer.com/users/l.php?url=https:%2F%%2Fusers%%3Furl%3Dhttp:%252F%%252Fpt%252FA42hBUju%26sig%3D50c67e1b3a7f27f20771fd2ee320f07b9eb302904f9e19edea3a28d328aafbdf&sig=dbffe148af4b5367f232a97a6acda81aea4364dfabcb09ccf07b413f3f1c3be9
Hi I need a reliable assistant/secretary to cut and paste data from websites into new contacts in Hubspot. You will get a list of links to companies like this one Your task is to extract the data and enter them into Hubspot. I am not sure how long it will take, so let's do it on an hourly basis. Please state your fee per hour. Please also write if you have experience with Hubspot. You will need a fast and stable internet connection. I look forward to working with you! Take care Erik
...mit team og jeg en komplet hjemmeside med et system programmeret i PHP & MYSQL, som skal fungere som et mellemled. Det som vi i virkeligheden ønsker os, er at sætte gang i hjulene på onlinedelen, og dermed få et godt tilbud til en fornuftig pris. Vores virksomhed sikre den private handel bliver gennemført præcis efter den indgåede aftale, ved at sælger og køber udføre handlen igennem vores platform, og dermed udelukker muligheden for svindel. Vi ønsker at hjemmesiden skal se moderne ud og helst noget der passer til vores branche. Der skal være gode muligheder for videreudvikling på senere tidspunkt. Vi ønsker at bruge farven blå, hvid og sort. Det skal se godt ud og kunden skal ...
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
Opgradering af booking system fra installation program til online booking system mysql Kan laves med komplet engelsk sprog men ved mulighed for at vi kan lave ekstra sprog som man kan vælge som kunde. Har beskrevet lidt om det i vedhæftet pdf.
Hello designers. My boss is looking for a logo that combines three different categories under the insurance umbrella. Home - Health - Car. Design anything you want that combines these 3 categories, in the insurance industry. Thanks
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Jeg har et ønske om at få udarbejdet et logo til en nyt tøjbrand. Navnet er Care, og jeg har forstillet mig at logoet skal centreres om noget varmt og elskværdigt. Såsom et hjerte.
Adempiere Finance Functional Consultant for desigining Ecommerce & Accounting System
Design A Catalog Of Products (1 Page)
Krav specifikation er på plads - Den opdateret version kommer senere.
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' pizza online ordrering system with sms gataway '
poster for online posts 3 pictures Bold
Hej, Mit navn er Frederik og jeg har fået en idé der omhandler odds/spille på kampe. Her er lidt information omkring projektet: At spille på fodboldkampe, tennis kampe, NBA og andre sportsgrene er populær i alle aldre nu til dags,...spillere som størstedelen af deres forslag, er vundet. Kunder på siden, der søger forslag, skal betale for at se premium spillernes forslag. Det skal siges det er gratis at oprette sig på siden og at oprette forslag. Har du spørgsmål, svarer jeg gerne, så fyr løs! Men det jeg søger, er et tilbud, højst sandsynlig af en programmør. Vi leder nemlig efter en der kan lave et system der passer til projektet. Altså et system der kan ...
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I'm seeking a consultant to help navigate the legal landscape of selling cigarettes through an online food delivery app from my shop in Tamil Nadu. Key Areas of Concern: - Licensing for online sales: I need clarity on what licenses are necessary to sell cigarettes online, and how to obtain them if I don't have them already. - Compliance: Understanding the legal requirements to ensure that my business is compliant with state and national laws. Current Licensing: - I currently possess a Cigarette and Other Tobacco Products (COTP) license, as well as a trade license and GST registration. Ideal Candidate: - A legal professional with experience in e-commerce and tobacco sales in India. - Understanding of health regulations and age verification requireme...
...has extensively worked in this domain. This is for continuous work. If things are suitable we can keep you for monthly retainer. Location, age and education does not matter. Your ability to do this work is the only criteria. We need artwork in Adobe file formats to be created. Some work or all work is important and hence client privacy and confidentiality is of paramount importance. Avoid sharing the same anywhere. We may give a couple of questions or some tests to check how good you are. Your prior history over here can help in this regard Work? Various things to be done. 1. Artwork for advertisements. 2. Creative material for banner ads. 3. Text and Image and Graphics on one single file which can be used to print ads. Keep the file editing option so that changes ...
I'm seeking a skilled graphic designer proficient in Adobe Illustrator to create a mockup drawing for a festival map. The design must adhere to a specific guideline that I will provide, and it should be a line drawing with perspective. Key Elements to Include: - Stages and performance areas - Food and beverage stalls - Entrance - Art works displa...with perspective. Key Elements to Include: - Stages and performance areas - Food and beverage stalls - Entrance - Art works display - Workshop - Restrooms and first aid stations Ideal Candidate: - Proficient in Adobe Illustrator - Experienced in creating venue mockups and festival maps - Able to follow detailed design guidelines - Skilled in line drawing with perspective - Understands the importance of visually representing...
I'm seeking a professional who can design an anomaly-based detection system for monitoring commercial drones. The key responsibility of the system will be to automatically attempt signal recovery upon detecting an intrusion. Ideal Skills and Experience: - Expertise in drone technology and commercial drone signals - Proficient in anomaly-based intrusion detection methods - Experience in developing automated signal recovery systems - Strong background in signal processing and telecommunications - Capable of creating a system that is efficient and reliable Please provide examples of similar projects you've completed in your proposal.
I'm seeking an SEO specialist for my League of Legends boosting service website. My primary goal is to boost online sales or conversions through effective SEO strategies. Key Requirements: - Comprehensive SEO: I need an expert who can handle all aspects of SEO including On-page, Off-page, and Technical SEO. - Targeted Approach: The main focus will be on improving our visibility in the UK, France, and Germany. Payment Structure: - Initial Payment: I'm willing to pay $65 for the first month, focusing on ranking 30 keywords. - Potential for Increase: Once we start seeing results and some keywords hit the first page, I will upgrade the monthly payment to $150. Please note, I've been advised that it typically takes 1 to 4 months to see significant results. Hen...
Seeking a marketing specialist experienced in social impact projects to execute a strategic marketing plan to boost visibility and engagement for our GoFundMe campaign focused on a mental health awareness film. Responsibilities include: - Collaborating with influencers and organizations within the mental health and film industry. - Developing targeted content strategies for various platforms including social media, blogs, and press releases. - Designing an effective PR strategy to secure media coverage in supportive outlets. - Optimizing our GoFundMe page to enhance reach and engagement. Success will be measured by the increase in visibility and donations received.
Greetings, I would like to obtain a list of 500 podcast specifically for their: 1) Email to book guest 2) Website 3) Social Media (Linked In, Youtube, Insta, Tik Tok) The 500 podcast with a focus area of: Men's Mental Health Black Men Mental Health Mental Health Police Mental Health First Responder / Fire Fighter Mental Health Corporate Mental Health Coaching Mental Health in Construction Mental Health in STEM Meditation Poetry Poetry and Mental Health Stoicism Burn Out More tasks available
I'm seeking a professional to design an infographic detailing dietary supplement advice for my dog. The infographic should encompass: - Potential side effects of various dietary supplements Ideal candidates would possess skills in research, graphic design, and a deep understanding of canine health and dietary needs. This project is perfect for individuals who can break down complex information into easily digestible content.
I require a visual overhaul of my exit sting software recruitment website, specifically the homepage and services page. The primary goal is to refresh the visual design to a more corporate and professional aesthetic. Ideal Skills: - Web Design - Graphic Design - UX/UI - HTML/CSS/JavaScript Proficiency Requirements: - Redesign the homepage and services page - Update the visual design to a corporate and professional style - Proposed completion within four days Need modification Need to be like this All are in wordpress so just need someone to work on. Please provide your proposal, including a timeline and your relevant experience.
PLEASE READ COMPLETELY PLEASE READ COMPLETELY PLEASE READ COMPLETELY Job Description: I’m seeking a skilled and proactive LinkedIn specialist for a 30-day project to manage lead generation and outreach campaigns for two businesses: 1. Your Space to Heal – Focused on securing corporate speaking engagements for mental health and wellness. 2. The Luxury Recharge Collection – A community for ambitious women learning to prioritize rest and recharge. This role involves optimizing LinkedIn profiles, using Sales Navigator to target ideal clients, crafting personalized messages, and nurturing leads to build meaningful connections and drive engagement. Responsibilities: • Optimize LinkedIn profiles for both brands to align with their messaging and goals. ...
I have user database with 6400 small portrait pictures (about 80 x 100 pixels) in jpg format. I would like to double their size to about (about 160 x 200 pixels) and use AI to avoid the quality issues from zooming in. The resulting jpg pictures should have a compression quality parameter of about 40% so that the pictures each have a size of less than 10 kB. I would send the 6400 pictures in a zip folder so you can send me the results.
Looking for an expert who can feel and think with this project. It’s a project where we need a full mortgage system with calculations, email, task follow up system, client Managment, process Managment, internal / external communication, document, rapports, billings, e-signing documents,… We have an existing flow ready for programming. We need an individual software, build from scratch, not odoo, or Zohoo, nor Monday. Let’s talk to see if we can be a good match!
