Filtrér

Mine seneste søgninger
Filtrer ved:
Budget
til
til
til
Slags
Færdigheder
Sprog
    Job-status
    2,000 good typing speed jobs fundet

    ...and the price of a box with its contents. - The visitor will enter the surface he needs, it will be rounded up to the next number of boxes that cover that area. - Or he will enter the number of boxes and see how much that is in terms of area. - Both fields are interconnected. - Show the total cost of his order. I will give you more details via chat if needed. I am really looking for someone with good english who can understand the whole picture and do what's needed to deliver a functional end result. I am not looking to micro manage and go through every trivial detail. Start your application with "magento wizard" so I know you actually read this. I am not looking to waste your or my time. Happy bidding. There is going to be more work for the right candidate....

    €295 Average bid
    €295 Gns Bud
    26 bud

    The specs for this project are Wordpress based / Editable in the backend of the site Fast in google page speed insights Goal is under 2 seconds on all pages WP rocket + CACHING + MINIMISE PICTURES Features Videos Picture slides Animation videos Editable text Editable pictures Editable blocks Editable logos Create unique URLS - SEO wise Design wishes 14 different logos containing the name of each “BRAND name” FIGMA only / UX optimizing just like on FIGMA project Requirements WORDPRESS BASED Able to connect up with our DIV - contact formular on - FROM OUR BACKEND DEVELOPER (RoR Ruby On Rails) It should always be possible to load external JS as the current one is based on, so I don't think they can make something that won't work with the type of solution we...

    €4326 Average bid
    €4326 Gns Bud
    52 bud

    Page speed for my website is so bad: I need this fixed. Plugins and website have to run the same way (unless we agree on disable).

    €127 Average bid
    €127 Gns Bud
    101 bud
    €10 Gns Bud
    1 bud

    typing,designing

    €14 / hr Average bid
    €14 / hr Gns Bud
    1 bud
    Microsoft Typing
    Udløbet left

    Typer of Files in Microsoft Office

    €6 / hr Average bid
    €6 / hr Gns Bud
    129 bud

    Database description Database to be run on Internet, with a small number of users, now 6 users. Login for each user, the database is not visible if you are not logged in. The database to be used for the creation and search of records. The information consists of standard personal data, address, and mail. Typing the postcode, the city name is found in an underlying base. Furthermore, there is the creation date / correction date 3 text fields and 2 dropdown field - and a note field. One drop down box shows the default login person (which is part of the drop down option) Searching is done on 3-4 fields individually, and results are displayed as list, which can be clicked on, as each result is displayed. The layout may be edit via CSS. The database must be a SQL database. Th...

    €265 Average bid
    Fremhævet Haster
    €265 Gns Bud
    9 bud

    Typing jobs, Form filling etc.

    €136 Average bid
    €136 Gns Bud
    18 bud
    SEO min Hjemmeside
    Udløbet left

    Jeg skal have lavet min side, så den er så tæt på 100 som muligt her Samtidig skal jeg have lavet SEO på min side - Du SKAL have referencer når du byder på denne opgave.

    €244 Average bid
    €244 Gns Bud
    9 bud
    DTP Job
    Udløbet left

    I Am DTP Operator Wedding Card, Visiting Card, Typing eng, mar, guj, hindi,

    €18 - €147
    €18 - €147
    0 bud
    €242 - €725
    0 bud
    Data Entry
    Udløbet left

    Typing , online form filling

    €10 - €29
    €10 - €29
    0 bud

    ...----------------------- Tekst om opskrift: Eksempel: "The meal consist of one cheese and olive Focaccia premade (I bet you could also make your own). A square is made in the middle of the bread so there is space for two eggs. The combo is topped with bacon and cress which add freshness and color to the breakfast/brunch recipe. This Focaccia egg and bacon food recipe is focused on making it with speed. Therefore this recipe will also learn you how to make bacon in the microwave......." (and so on) ----------------------- Ingrediensliste: 1 x Cheese and olive Focaccia premade bread 2 x Eggs 1 x Mango ..... o.s.v. ----------------------- En liste af hvordan opskrift udføres. 1 - Først tager du 2 - Så gør du 3 - N&ari...

    €96 Average bid
    €96 Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €18 - €147
    €18 - €147
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €69 Average bid
    €69 Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €105 Average bid
    €105 Gns Bud
    1 bud
    PROJECT OF TYPING
    Udløbet left

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €105 Average bid
    €105 Gns Bud
    1 bud

    Mit navn er Jonas og jeg er Webudvikler med mere end 7 års erfaring i branchen. * Primært fokus er Webudvikling (HTML/CSS, PHP, MySQL, JavaScript) * WordPress ekspert * Gennemtænkte løsninger, så du undgår unødvendig langtrukne projekter og ekstraarbejde * Kort leverings- og responstid (Haste opgaver er intet problem) * Kompetent rådgivning er vigtigere end øget salg (også selvom man er sælger)

    €29 - €242
    €29 - €242
    0 bud
    A good job
    Udløbet left

    Mit navn er Jonas og jeg er Webudvikler med mere end 7 års erfaring i branchen. * Primært fokus er Webudvikling (HTML/CSS, PHP, MySQL, JavaScript) * WordPress ekspert * Gennemtænkte løsninger, så du undgår unødvendig langtrukne projekter og ekstraarbejde * Kort leverings- og responstid (Haste opgaver er intet problem) * Kompetent rådgivning er vigtigere end øget salg (også selvom man er sælger)

    €145 - €145
    €145 - €145
    0 bud
    Good Writer
    Udløbet left

    Check PMB for details...

    €2 / hr Average bid
    €2 / hr Gns Bud
    1 bud

    I'm seeking an SEO expert to help with keyword research and optimization, as well as technical SEO issues related to website speed. Specific needs: - Comprehensive keyword research and optimization - Technical SEO diagnosis and solutions for website speed issues - Assistance with audit problems identified in SEMrush and Rank Math Ideal candidates should: - Have extensive experience in SEO and website speed optimization - Be proficient in using SEMrush and Rank Math - Have the ability to diagnose and fix technical SEO issues - Be able to assist with audit problems

    €10 / hr Average bid
    €10 / hr Gns Bud
    47 bud

    ...detection mechanisms. • Requirements: 1. Fingerprint Randomization: o Integrate browser fingerprinting tools or libraries to randomize fingerprints (e.g., canvas, WebGL, fonts, plugins, and user agents) for each session. o Ensure that each fingerprint is unique and cannot be linked to previous sessions. 2. Behavioral Humanization: o Implement random delays and variations in mouse movements, typing speed, and scrolling. o Introduce subtle "human-like" errors, such as mistyping and correcting inputs. o 3. Cookie and Cache Management: o Clear cookies and cache between sessions to remove residual data. o Randomize storage settings, including local storage and IndexedDB, for further anonymity. o 4. Anti-Bot Evasion: o Integrate tools such as Puppeteer Stealth or ...

    €130 Average bid
    €130 Gns Bud
    66 bud

    ...Form: A functional contact form so potential clients or employers can reach out to me. Blog Section (optional): A simple blog feature to post updates or share insights related to my field. SEO Optimization: Ensure the site is optimized for search engines to help it rank well. Social Media Integration: Links to my professional social media profiles (LinkedIn, GitHub, Instagram, etc.). Fast Loading Speed: The website should load quickly and efficiently. Content Management System (CMS): I’d prefer a CMS like WordPress, Webflow, or another easy-to-use platform so I can manage content after the site is built. Skills Needed: Experience in HTML, CSS, JavaScript, and modern web development frameworks. Familiarity with UI/UX design to create a visually appealing experience. Experien...

    €83 Average bid
    €83 Gns Bud
    58 bud

    I'm looking for a computer whiz with a knack for data typing jobs. The job primarily involves data entry from scanned documents, which can include both numerical and textual information. Ideal skills and experience for the job: - Proficient in data entry - Able to handle mixed data types (numerical and text) - Experienced in working with scanned documents, online database as well written documents. - High attention to detail - Fast and accurate typing skills

    €241 Average bid
    €241 Gns Bud
    110 bud

    ...Transform encoding (DCT/wavelets/learned transform). Motion estimation and prediction. Entropy coding. Output: Save the compressed file in a container format (e.g., MP4, MKV). >>>Step 6: Testing and Benchmarking Metrics to Track Compression Ratio: Measure file size reduction. Quality Metrics: PSNR (Peak Signal-to-Noise Ratio). SSIM (Structural Similarity Index). Performance: Encoding/decoding speed. Compatibility: Test across devices and platforms. Datasets Use publicly available datasets like Vimeo-90k or create your own. Tools FFmpeg for benchmarking. Tools like MSU Video Quality Measurement Tool for quality analysis....

    €505 Average bid
    €505 Gns Bud
    34 bud

    I need a professional web designer to improve the user experience of my site. The main focus areas will be: - Optimising loading speed: The site currently has some latency issues that need to be resolved. - Enhancing interaction: The site features several interactive elements, such as forms and widgets. These need to be made more intuitive and engaging. The ideal candidate for this project should have a strong background in UX design, web optimisation and interactive web elements. A portfolio showcasing previous website redesigns will be highly advantageous. We have a themealready from Themeforest, so i need you to copy the data across, make sure everything works ok. ******** DO NOT CALL US ABOUT THIS OFFER *************

    €401 Average bid
    €401 Gns Bud
    249 bud

    I need an SEO expert who can optimize my entire website, particular...covers on-page, off-page, and technical SEO - Proven ability to significantly enhance search engine rankings - A track record of improving website visibility on Google Skills: - In-depth knowledge of SEO - Proficient in Digital Marketing - Expert in Google Analytics - Skilled in Content Optimization - Excellent in Keyword Research Specific focus areas include: - Technical SEO improvements: Site speed optimization, Mobile-friendly enhancements, Indexing and crawling improvements - Content Optimization: Product descriptions, Metadata (titles and meta descriptions), Images and videos I am looking for someone who can not only improve my website's SEO but also provide a clear and actionable report on the progre...

    €38 Average bid
    €38 Gns Bud
    29 bud

    ... - Develop a responsive layout for mobile and desktop. - Implement a booking system with custom options for packages and add-ons. 3. **Payment Gateway Integration (15%)** - Integrate payment options like UPI, credit/debit cards, and wallets. - Test the payment flow for seamless transactions. 4. **Testing & Final Revisions (15%)** - Conduct testing for responsiveness, speed, and usability. - Make revisions based on feedback. 5. **Launch & Training (10%)** - Deploy the site to the live domain. - Provide documentation and basic training on how to update content. --- **Skills Required:** - Web Design & Development (WordPress, Custom CMS) - Booking System Integration - Payment Gateway Setup - UI/UX Design Expertise ...

    €103 Average bid
    €103 Gns Bud
    49 bud
    Animated Ad for Grocery App
    6 dage left
    Godkendt

    I'm seeking a skilled video producer and animator to create an engaging, animated advertisement for my grocery shopping app aimed at small towns. K...skilled video producer and animator to create an engaging, animated advertisement for my grocery shopping app aimed at small towns. Key Focus: - The primary aim of the video is to promote the app's features, particularly the easy ordering process and fast delivery options. - The animation should be captivating and clearly illustrate the app's user-friendly interface and its competitive delivery speed. Ideal Candidates: - Proven experience in creating animated advertisements. - Prior work with app promotion is a plus. - Strong portfolio demonstrating creativity and understanding of conveying complex information in a...

    €71 Average bid
    €71 Gns Bud
    19 bud

    ...postgraduate project. The purpose of the assessment is to identify and rate hoarseness in the samples. Key Aspects: - Assessment of 68 voice samples for hoarseness using GRBAS scale - Provide a score summary with comments for each sample The most critical aspect of this project is overall accuracy of the assessments. Given the nature of the project, consistency across samples is also important. While speed of assessment is not as critical, timely completion of the assessments before the project deadline of October 31, 2025 is essential. Compensation will range from Rs. 150-250 for each sample assessed, based on your level of experience. The status of 'Expert Consulatnt' will be given in the dissertation work of this project. If you're interested, please don'...

    €147 Average bid
    €147 Gns Bud
    7 bud

    As discussed will proceed for those 5 images

    €21 Average bid
    €21 Gns Bud
    1 bud

    I'm seeking a seasoned professional to conduct a thorough page speed SEO analysis for my e-commerce site. The main focus areas of concern are: - Loading time: It's critical that my site loads swiftly to provide a seamless shopping experience for my customers. - Server response time: Any delays at this stage can lead to potential lost sales. Currently, I have no tools or plugins installed for optimizing page speed. So, an individual with expertise in this field will be essential in identifying potential issues and suggesting effective solutions. Ideal Skills: - SEO expertise, particularly in relation to e-commerce - Proficiency in web analytics and page speed tools - Experience in recommending and implementing page speed optimization tools and plug...

    €37 Average bid
    €37 Gns Bud
    33 bud

    ...product information from scanned or digital product portfolio brochures. • Accurately input product details into our database. • Verify data accuracy and consistency after entry. • Report any unclear or missing information promptly. Performance Monitoring and Work Schedule • The project will begin with an initial test phase of 2 hours, during which we will evaluate your performance, accuracy, and speed. • Based on successful completion of the test phase, we anticipate requiring approximately 20 hours of work per week moving forward. • We will track the time spent on data entry using our system to ensure efficiency and accuracy. • Based on the results of the test phase, we will set a maximum time allowance per record. Payment will be capped acco...

    €3 / hr Average bid
    €3 / hr Gns Bud
    112 bud

    I'm looking for a freelancer who can help with typing data from a Word document into a PDF. The data source and document purpose are yet to be defined, so flexibility and adaptability are key. Ideal skills for this project: - Excellent typing skills - Proficiency in Microsoft Word and Adobe PDF - Attention to detail - Ability to maintain confidentiality - Good time management skills Please note that this project does not require special formatting. However, the ability to follow instructions and adapt to any potential requirements is essential.

    €11 / hr Average bid
    €11 / hr Gns Bud
    325 bud

    ...to meet Google AdSense approval requirements. The ultimate goal is to achieve AdSense approval, after which payment will be provided. Responsibilities: Content Creation: Develop and publish high-quality, original, and engaging content tailored to AdSense guidelines. Site Optimization: Ensure the WordPress site is designed and optimized for AdSense compliance, including layout, navigation, and speed. SEO Strategy: Implement effective SEO practices to drive organic traffic and enhance the site's visibility. AdSense Compliance: Ensure all aspects of the site adhere to AdSense policies, including copyright, content quality, and user experience. Niche Decision-Making: Identify the best niche or topic for the website based on trends and AdSense compatibility. Requirements:...

    €21 Average bid
    €21 Gns Bud
    41 bud

    ...visitors and generate quality leads. Website URL: Requirements: - Conduct a thorough audit of the website to identify SEO improvement areas. - Implement on-page SEO, including keyword optimization, meta tags, image alt texts, and content structuring. - Enhance off-page SEO, including backlink building and domain authority improvement. - Improve website loading speed for both desktop and mobile. - Optimize images, scripts, and stylesheets for better performance. - Ensure mobile responsiveness and cross-browser compatibility. - Set up and optimize Google Analytics and Search Console. - Provide a detailed report on implemented changes and their impact. - Review the current design and UX for potential enhancements. - Share additional recommendations for improving

    €29 - €242
    Forseglet
    €29 - €242
    105 bud
    PDF Typing Work
    6 dage left

    I'm seeking a freelancer to transcribe a 10-50 page PDF document containing primarily textual data. The task requires exact replication of the original document without any alterations or simplifications in formatting. Ideal Skills: - High typing speed and accuracy - Excellent attention to detail - Proficiency in data entry and transcription Experience: - Prior experience with PDF typing or similar tasks is preferred - Familiarity with maintaining formatting consistency during transcription

    €17 / hr Average bid
    €17 / hr Gns Bud
    272 bud

    I'm looking to enhance the speed of my WordPress website primarily to achieve faster load times. The homepage is the key focus for this optimization project, as it's the first point of contact for most visitors. Key tasks: - Optimize the overall speed of the homepage using the WP Rocket plugin. - Optimize multimedia content on the homepage, specifically images and videos. Ideal freelancer should have: - Extensive experience with WordPress and the WP Rocket plugin. - Strong skills in multimedia optimization. - Proven track record of improving website speed.

    €124 Average bid
    €124 Gns Bud
    297 bud

    I'm seeking a professional with experience in manual data entry to assist with transferring information from printed, highly detailed and complex reports into digital formats. Key Responsibilities: - Accurately inputting data from printed documents - Interpreting and transferring specialized formatting and annotations Ideal Skills: - Excellent typing skills - High attention to detail - Proficient in interpreting complex information - Ability to maintain confidentiality - Meet deadlines consistently Every report includes annotations that will need to be considered and transcribed. Your ability to understand and accurately capture this information will be crucial. I appreciate your professionalism and commitment to delivering high-quality results. Let's discuss how you...

    €10 / hr Average bid
    €10 / hr Gns Bud
    69 bud

    ...Contact Forms: Implement user-friendly forms with anti-spam features. Live Chat/Support: Integrate live chat or a chatbot for customer assistance. Newsletter Integration: Add subscription forms with GDPR compliance. Social Media Links: Provide links to your social channels. 7. Testing and Launch Functional Testing: Test all forms, buttons, and interactive elements. Performance Testing: Check page speed, mobile responsiveness, and loading times. Browser Compatibility: Test the website on all major browsers. Analytics Setup: Install tools like Google Analytics to track performance. Launch: Plan a promotional campaign for the new website. 8. Post-Launch Monitoring and Updates Monitor website performance. Collect user feedback and implement changes. Regularly update content and graph...

    €1095 Average bid
    €1095 Gns Bud
    261 bud

    I have a number of text document PDFs that need to be typed into Google Docs. The project requires basic standard text formatting. Ideal skills and experience include: - Proficient typing skills - Familiarity with Google Docs - Attention to detail to ensure accurate transcription and formatting

    €17 / hr Average bid
    €17 / hr Gns Bud
    260 bud

    I am in need of a seasoned technical writer with a strong background in crafting research papers. Your task will be to assist in writing and editing these documents. Ideal Skills: - Proficient in technical writing - Experience in writing research papers - Exceptional writing and editing skills - Ability to understand complex concepts and simplify them - Attention to detail Your primary responsibility will be to help articulate intricate ideas clearly in writing. Prior experience in this field is highly valued. Looking forward to your bids.

    €9 / hr Average bid
    €9 / hr Gns Bud
    10 bud

    I need a freelancer with exceptional data entry skills to assist me in typing data into Excel. I have a general idea of how I want the data formatted, but I will need your expertise and assistance to create a comprehensive and effective template. Ideal Skills: - Proficient in Excel - Strong attention to detail - Excellent typing skills - Good understanding of data entry and formatting Experience: - Previous work with data entry and Excel is crucial. - Experience in creating Excel templates will be highly beneficial. I am looking for someone who is reliable, can work independently and can deliver quality work on time. If you believe you fit this description, I would be happy to discuss this project further with you. Thank you.

    €10 / hr Average bid
    €10 / hr Gns Bud
    164 bud

    I have an academic paper in PDF format that needs to be typed into a Word document. The project entails: - Typing the document accurately without any typographical errors. - Formatting the document in accordance to APA format. The document is approximately 1-10 pages long. Attention to detail and familiarity with academic writing and APA formatting are essential.

    €14 / hr Average bid
    €14 / hr Gns Bud
    161 bud
    PDF Typing Task
    6 dage left

    I'm looking for a freelancer to help me with a typing task. I have a number of PDF documents that I need transcribed. The PDFs contain: - Text only (no images or handwritten notes) - In English The typing requirements are straightforward: - No special formatting is needed, just a clean transcription of the text Ideal skills and experience for the job: - Fast and accurate typing skills - Proficiency in English - Attention to detail to ensure accurate transcription - Experience with PDF typing tasks preferred If you can deliver a clean, accurate transcription in a timely manner, I look forward to hearing from you.

    €10 / hr Average bid
    €10 / hr Gns Bud
    287 bud

    ...website's technical SEO. I've already invested in SEMrush and Rank Math (both premium versions) to facilitate this process. The areas I particularly need assistance with include: - Site speed optimization: I want my website to load faster, improving user experience and potentially boosting my search engine ranking. - Crawlability and indexing: I need to ensure search engines can effectively crawl and index my site. I prefer using Google PageSpeed Insights for monitoring site speed. The ideal candidate for this project will have extensive experience in technical SEO, with a proven track record of optimizing site speed and improving crawlability and indexing. Familiarity with SEMrush and Rank Math is a plus, but not a requirement. I am looking for someon...

    €12 / hr Average bid
    €12 / hr Gns Bud
    124 bud

    I'm looking for someone to type a formal job application letter for me. The letter needs to include my personal background and qualifications. It should be professional, clear, and concise to make a strong impression. Ideal skills for this project include: - Proficient typing skills - Excellent command of English language - Experience in writing professional letters - Familiarity with formal letter format

    €10 / hr Average bid
    €10 / hr Gns Bud
    57 bud

    I need a professional typist to convert my handwritten notes into Google Docs. The content consists of business reports. Ideal skills and experience for the job: - Proficient in typing and Google Docs - Attention to detail - Familiarity with business terminology - Ability to meet deadlines

    €11 / hr Average bid
    €11 / hr Gns Bud
    159 bud

    I'm in need of a seasoned SEO professional who can help boost my retireme...goal is to rank higher on search engines and generate leads. Key Responsibilities: - Conducting a thorough SEO audit using Google Analytics - Identifying key phrases and keywords relevant to the retirement sector in Malaysia - Implementing effective on-page, off-page and technical SEO strategies Requirements: - Comprehensive analysis of my site's content - Evaluating my site's performance and speed - Proposing and executing actionable SEO strategies to improve search engine ranking Ideal Skills and Experience: - Proficient in using Google Analytics - Extensive knowledge in SEO techniques - Experience in optimizing websites for lead generation - Familiarity with the retirement sector in Mala...

    €40 Average bid
    €40 Gns Bud
    73 bud

    ...improving the site's features and performance. However, preserving the site's custom functionalities is my top priority. These include various plugins and apps that are integral to my site. Key tasks: - Thoroughly testing all plugins and apps post-update to ensure they function seamlessly before going live. - Preserving custom functionalities during the update. - Ensuring the site's design, layout, speed, and performance remain unaffected. - Completing this task before the 6th of January. The types of plugins and apps in use include: - Marketing and SEO tools - Inventory management systems - Customer reviews and feedback platforms - Product customization and personalizer apps - Loyalty applications Ideal candidates for this project should have: - Extensive expe...

    €98 Average bid
    €98 Gns Bud
    162 bud