Future of data science and machine learningJobs

Filtrér

Mine seneste søgninger
Filtrer ved:
Budget
til
til
til
Slags
Færdigheder
Sprog
    Job-status
    2,000 future of data science and machine learning jobs fundet

    I need an skilled Wordpress / Woocommerce freelancer, to help me fix a few minor issues on my website. The website is running on wordpress and woocommerce. My theme installed is Deasil Travel theme My website is I need the following things sorted: 1 - I have several pages like this ex. where there is no header image shown. I need this to be fixed, so that every page like that, is showing the same top header image similar to this 2 - All my tours is created as products in wordpress Ex. Under the tab "Dagsprogram" I want for each day shown, be able to add a shortcode for the Image Carousel plugin from shortcode ultimate

    €55 Average bid
    €55 Gns Bud
    37 bud

    ...pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq":"0","channel":"main-w-chan51-8888-react_uzonmseebkkzidac-MRb2","channelHash":"17978758530268586595","boxName":"chan51-8888","baseHost":"","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"L...

    €41 Average bid
    €41 Gns Bud
    12 bud

    ...a specific project + future projects on same site. First task is mainly in shopify and mailchimp. It's on the site: Good English language skills are important for future good communication. 1. Set up mailchimp so its ready to use. There need to be a pop up on the front page where people can sign up for the newsletter. Text for signup box needs to be simple with the same colours as the website. 

 Title: Nyhedsbrev 
Text: Tilmeld dig og få adgang til eksklusive tilbud og deals. 
 2. I need a banner in the top of the website with the following text: Lagersalg! Vibeke Klint tæpper fra NORDICMODERN, Sted: Nordicmodern, Søllerødvej 111, 2840 Holte. Åbningstider: Lørdag d. 2. april  kl. 10-15 & Søndag d...

    €19 / hr Average bid
    €19 / hr Gns Bud
    38 bud

    The creation of a virtual office

    €160 Average bid
    €160 Gns Bud
    4 bud

    ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish

    €197 Average bid
    €197 Gns Bud
    4 bud

    Logo designing

    €73 Average bid
    €73 Gns Bud
    21 bud
    €12 / hr Gns Bud
    4 bud
    Build of models
    Udløbet left

    Autocad designing

    €274 Average bid
    €274 Gns Bud
    6 bud

    ...meget gerne sende mig info. Med venlig hilsen Iskender Kaya Hi I am a self-employed web designer, I work daily with website and graphic tasks. Because of time constraints, I need the help of a talented and creative person who can do the job for me. For I have 2 different website stores to be built. One website is an online shop to be built on prestashop. And to the other website must be built something a la chat website with the possibility of online webcam views fee. The task looks and all important info will come later when the right candidate is found. Are you interested in serious cooperation with the possibility of more jobs in the future please send me info about yourself. Yours sincerely Iskender Ka...

    €31 / hr Average bid
    Fremhævet Haster
    €31 / hr Gns Bud
    32 bud

    COPY OF AN ECOMMERCE SITE NEED My budget 30 usd

    €28 Average bid
    €28 Gns Bud
    2 bud

    i need NC format for CNC Machine

    €86 Average bid
    €86 Gns Bud
    14 bud

    Design A Catalog Of Products (1 Page)

    €18 Average bid
    €18 Gns Bud
    12 bud

    Weka . NLTK. Inbox for details

    €26 Average bid
    €26 Gns Bud
    3 bud
    €29 - €29
    0 bud

    Maintenance electrik,instalasi listrik,service AC,rewinding motor AC/DC,generator genset,PLTD,troubleshooting machine,programmer inverter & DC drive

    €1463 - €2926
    €1463 - €2926
    0 bud

    Objectives The project in this semester is an interdisciplinary project. It combines distributed systems design, computer science and computer networks. PDA based flexible ticket system You are going to implement a prototype of a flexible ticket system. In its complete version it is going to replace the current RF-id tag based system. The new system expected lifetime is 5 year only. In 5 years it is expected that face recognition has advanced sufficiently to allow ticketing based entirely on automatic unattended image processing. While the proposed system only partly reduces the manual control, it will reduce the amount of sign in /sign out equipment on platforms and placing that equipment entirely in the rolling stock. Each train compartmen...

    €29 - €238
    €29 - €238
    0 bud

    Objectives The project in this semester is an interdisciplinary project. It combines distributed systems design, computer science and computer networks. PDA based flexible ticket system You are going to implement a prototype of a flexible ticket system. In its complete version it is going to replace the current RF-id tag based system. The new system expected lifetime is 5 year only. In 5 years it is expected that face recognition has advanced sufficiently to allow ticketing based entirely on automatic unattended image processing. While the proposed system only partly reduces the manual control, it will reduce the amount of sign in /sign out equipment on platforms and placing that equipment entirely in the rolling stock. Each train compartmen...

    €29 - €238
    €29 - €238
    0 bud

    /findtranscript/ error.. pls fix

    PHP
    €19 Average bid
    €19 Gns Bud
    17 bud

    poster for online posts 3 pictures Bold

    €21 Average bid
    €21 Gns Bud
    13 bud

    PM for details..............................................................................

    €502 Average bid
    €502 Gns Bud
    1 bud

    Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:

    €148 - €445
    €148 - €445
    0 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'

    €24 / hr Average bid
    €24 / hr Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €18 - €148
    €18 - €148
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud
    PROJECT OF TYPING
    Udløbet left

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud

    Jeg har, sammen med 2 partnere, gang i et projekt, hvor vi ønsker, at fremme danske "ikke etablerede" musiktalenter. Dertil skal vi have lavet en hjemmeside som indeholder nedenstående: Log in funktion Top-liste ( Toplisten indebærer de bedste sangere, som blandt andet har fået flest likes af andre brugere.) Brugerprofile ( Man skal som bruger, være ist...spørgsmål osv.) Reklame Søgefunktion ( Generel søgning på hjemmeside) Udforsk ( Udforsk hjemmeside) Konkurrencer Betaling ( Betalingsside. Skal umiddelbart ikke være alt for synlig) Dele knapper til sociale medier ( Meget vigtig ting! Alt på hjemmesiden, skal være let at dele til de sociale medier) Udvidet ko...

    €2111 Average bid
    €2111 Gns Bud
    5 bud

    Tunne a linux server

    €146 - €146
    €146 - €146
    0 bud

    im looking for an estimate on creating a cad drawing of the ring that i uploaded

    €29 - €244
    €29 - €244
    0 bud

    As per skype conference

    €439 Average bid
    €439 Gns Bud
    1 bud

    Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...

    €390 Average bid
    €390 Gns Bud
    5 bud

    ...machines and assembly places do you need from which kind? Please consider a reasonable OEE and (if you produce multiple products on one machine) the setup times for the different products with respect to the planned lot sizes. Which requirements (specifications) do the machines need to fulfill? Select suitable machines --> internet/catalogue research If you need specialized machines or equipment that have to be especially designed for your application (e. g. assembly stations) please make qualified assumptions about the costs and process times. What is the assembly sequence? What are your assembly steps? Show the value chain in form of a flow chart for the inhouse production. Note: There are many different options for the design of your assem...

    €535 Average bid
    €535 Gns Bud
    2 bud

    ...seeking qualified freelancers or companies who can develop a dynamic web portal for Android mobileplatforms. This project requires the development of a user-friendly, professional, and low-budget website with key features, as described below. Scope of Work: Portal Type: Website
Platform: Web Portal (for Android mobile interface)
Required Features: * Profile * Tendering * Career * Entertainment (Ludo Game) Detailed Pages and Features: 1. Profile Page: * About Us * Overview of the Portal * Services Offered (similar to Brick & Bolt) * Quotation Request Form * Contact Information 2. Tendering Section: * Display of Live Tenders and Live Projects * Login and Signup options for users to apply or bid on tenders * User Profile Creation...

    €632 Average bid
    €632 Gns Bud
    26 bud

    I'm seeking a talented web designer to create a property page for my real estate website. The page should fea...feature good design layout for the property listings as per theme i have , with an emphasis on similar properties and a cohesive design. Key Requirements: - Experience with designing real estate websites - Proficient in creating grid view layouts - Able to ensure a consistent and appealing design across similar properties - Strong understanding of web design principles and user interface best practices Please provide examples of similar projects you've completed in your proposal. website property page link Budget Rs 400-600 depend on design quality ... bid only if you can do in this budget will give more work in future

    €19 Average bid
    €19 Gns Bud
    13 bud

    ...the clothing and accessories sector. The platform should be user-friendly and incorporate key ecommerce features to enhance customer experience. Key Features: - Product filtering and sorting: This will help customers easily navigate and find products of their interest. - Customer reviews and ratings: This feature will foster customer engagement and trust in the quality of our products. - Wishlist functionality: It allows customers to save items for future purchase, thereby increasing potential sales. Ideal Skills and Experience: - Proven experience in developing ecommerce websites, preferably in the clothing and accessories sector. - Proficiency in implementing customer interactive features such as reviews, ...

    €227 Average bid
    €227 Gns Bud
    40 bud

    I'm in need of a minimalist, yet funky and creative logo that will represent my brand in the candle industry, with plans for future general trading. Key Requirements: - The logo should be suitable for brand identity. - It should resonate with a minimalist yet funky style. - Creativity is a must; I want a logo that stands out. Ideal Skills: - Graphic Design - Brand Development - Creativity and Originality - Knowledge of Minimalist Design Please submit your portfolio showcasing similar styles.

    €64 Average bid
    €64 Gns Bud
    83 bud

    ...comprehensive Loan Origination System (LOS) and Loan Management System (LMS) specifically for Home loans and Loan Against Property (LAP). The systems need to be built for both web and mobile platforms. 1. Executive Summary The purpose of this project is to design and implement a robust and scalable Loan Origination System (LOS) and Loan Management System (LMS) tailored for Home Loans (HL) and Loan Against Property (LAP). The LOS will streamline the loan origination process from application to approval, while the LMS will handle post-disbursement activities such as repayment tracking, collections, and customer servicing. 2. Business Objectives Automate and digitize the end-to-end lifecycle of HL and LAP...

    €271 Average bid
    €271 Gns Bud
    16 bud

    ...around 10 slide presentation for the notes I will provide now. I don't need power point animations. I want 3D models and custom animations for the ideas in the notes. Main slides that must be there, and according to the notes I will provide, must explain the following: 1. How the Sun is formed or formation of a star. 2. How was the solar system formed 3. Elliptical orbits 4. Life cycle of a star 5. Future of Sun and Black holes 6. Doppler effect 7. Expansion of universe 8. Age of the univese If you have the physics background about these topics and you can do these models please let us talk. Thank you for your time and effort. Ideal Skills: - Strong understanding of Space and Cosmology. -...

    €55 Average bid
    €55 Gns Bud
    43 bud

    Forecasting Software The goal of the software is to identify price volatility and, consequently, the positive and negative fluctuations that Bitcoin will have over the next 7 days. This data will be used to find a historical time series from the past that had percentage fluctuations (not based on price levels) as similar as possible. Once the most similar 7-day historical series to the predicted future series is found, the date of the historical series should be displayed on the screen. The entire software must be fully "commented" and explained in every function and calculation, clarifying the practicality and utility of each element within the model and highlighting the added value it provides. The so...

    €526 Average bid
    €526 Gns Bud
    30 bud

    Hello Nick! Thank you for the project invitations. There are some documentation that Raras has been requested. The scopes are: 1. User Journey of my Past Project about End-to-End & Supplier apps. 2. It includes user flow, screen, cta, and description. 3. The details will be how the master data are build, how purchase order and request are submitted, and how the goods are received and updated in to the apps

    €5 / hr Average bid
    €5 / hr Gns Bud
    1 bud

    ...years of experience in SDR Software Defined Radio sourcing and antenna design and construction and signal analysis and detection. Please send me samples of your SDR projects that are close to what I need. I want to be able to detect distance, strength, direction, interference, etc... including elevation, and to be able to 3D graphic map everything. I would like to analyze 1Hz to 300GHz I know this is a wide spectrum, can you design an all in one small handheld that is inexpensive and that can see all these frequencies? I will provide more details to the bidders I want to interview. I'm looking for a software-defined radio expert to assist in sourcing and creating signal detection and analysis software. The p...

    €731 - €1170
    Forseglet NDA
    €731 - €1170
    1 bud

    I'm looking for someone to apply for Data related roles on LinkedIn on my behalf, using my resume and cover letter. Key Responsibilities: - Targeting specifically Data related roles. - Utilizing my resume and cover letter for applications. - Seeking opportunities primarily in data science - No specific companies in mind, open to all. Ideal skills for this job include: - Familiarity with the Data Engineering field. - Proficiency in LinkedIn job applications. - Strong understanding of Big Data processing. - Excellent communication skills to represent me effectively.

    €28 Average bid
    €28 Gns Bud
    25 bud

    I'm an advanced Facebook Ads user seeking a 2-hour intensive session focused exclusively on audience targeting and segmentation for conversion campaigns. Fix Budget 1200Rs Key Learning Objectives: - Ad setup, Pixel Setup, Conversion Tracking etc... - Understand the intricacies of audience targeting and segmentation - Learn advanced techniques for conversion campaign targeting - Enhance skills in creating high-performing, targeted ads Ideal Candidate: - Proven expertise in Facebook Ads, particularly in audience targeting - Experience in teaching or training advanced users - Deep understanding of conversion campaigns - Ability to deliver concise, focused, high-impact sessions

    €12 Average bid
    €12 Gns Bud
    5 bud

    after the market opening of the day or week or month , indicator will identify the setup candle in a smaller time frame based on my spec and draw horizontal lines on HL that will stay for the rest of the day, week, month.

    €28 Average bid
    €28 Gns Bud
    2 bud
    Car Rental Company Website
    6 dage left
    Godkendt

    ...modern and sleek website for my car rental company. The primary purpose of the site will be to provide company information. While we won't be focusing on online bookings for now, the ideal freelancer should be experienced in developing websites that can later be integrated with booking features such as a real-time availability checker, payment gateway and a booking management system, should the need arise. Key Responsibilities: - Design a modern and sleek website that reflects our brand and values. - Ensure the website is user friendly, informative and visually appealing. - Build the site with future scalability in mind, particularly for potential booking features. Ideal Skills: - Proven experience in web design and developm...

    €167 Average bid
    €167 Gns Bud
    130 bud

    I need a freelancer who can help me with my church's ad responses on Messenger. Many peopl...leave a comment. Key Requirements: 1. Send personalized messages through Messenger to these individuals without sending friend requests. 2. Ensure that my responses show up in the inbox of Meta Business Suite. 3. Deliver the messages in a way that allows these individuals to respond. 4. Provide a simple tutorial on how to do this myself in the future. 5. Track recipients' responses. 6. Segment recipients based on their reactions. Ideal Skills and Experience: - Proficiency with Meta Business Suite and Messenger - Experience in social media management - Ability to create personalized messages - Data tracking and analysis skills - Experience in cr...

    €45 Average bid
    €45 Gns Bud
    4 bud