Example of a film reviewJobs
Danish Recording Project We have a project, that needs Native Danish speakers, we will give you the text, and you need to record 1166 short sentences. you just need to download our software, to read our text and record it, it's a very easy job. 1. You will need to record in a quiet place without loud background noise. and without an echo. 2. Each person Price is 40$ for 1166 short sentences record. If you are interested please let me know sure. I will contact u. A Good Opportunity For New Freelancers For taking 5 Star Review after their completion of the project. Thanks :
EGSON er i gang med deres første store produktion "En Skriftlig Prøve". En kort film på 17 minutter der kunne bruge en hjælpende hånd. Vi er to unge fyre, som bruger al vores fritid på at lave film, så vi forhåbentligt på et tidspunkt, kan leve af det. Men det kræver selvfølgelig en masse tid, hårdt arbejde, og ikke mindst; forberedinger. Vi har optaget hele filmen, og nu i gang med post-produktion, men på trods af vores mange års erfaring med at redigere på egen hånd, er vi ikke tilfredse med vores lyddesign på filmen. Så det er på tide at lægge vores stolthed væk, og bede om hjælp på de punkter vi ikke selv er bedst. Vores ...
Hej Dinesh L., Jeg lagde mærke til din profil, og vil gerne tilbyde dig et projekt. Vi kan diskutere detaljer over chat.
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Jeg vil gerne ha lavet en plakat med nogle citater fra en film, som er opstillet på en bestemt måde!
Design A Catalog Of Products (1 Page)
poster for online posts 3 pictures Bold
I need someone writing a number of good SEO quality articles for a new real estate website. For instants: "Are you looking for buying a new flat in London? Do you like to live in the middle of London? Do you wish to..." 1. Articel/blog about: "Flats for sale" 2. Articel/blog about: "Flats for rent" 3. Articel/blog about: "Student residence for rent" 4. Articel/blog about: "Residential rental" 5. Articel/blog about: "Property in London for rent" 6. Articel/blog about: "Property in London for sale" The size of each article should be like: "Lejlighed København Kunne du tænke dig at gå en tur på Langelinje om morgenen, shopp...
I need someone writing a number of good SEO quality articles for a new real estate website. For instants: "Are you looking for buying a new flat in London? Do you like to live in the middle of London? Do you wish to..." 1. Articel/blog about: "Flats for sale" 2. Articel/blog about: "Flats for rent" 3. Articel/blog about: "Student residence for rent" 4. Articel/blog about: "Residential rental" 5. Articel/blog about: "Property in London for rent" 6. Articel/blog about: "Property in London for sale" The size of each article should be like: "Lejlighed København Kunne du tænke dig at gå en tur på Langelinje om morgenen, shopp...
Vi har en masse gode klip af dræbersnegle der bliver fanget i en fælde som vi har konstrueret, vi har også lavet en simpel fim af det, men vi vil gerne have lavet en film der har en masse humor, og henvender sig til målgruppen som er kvinder +35 Se evt vores nuværende film på:
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Jeg har en række artikler på Dansk som jeg gerne vil have oversat til Svensk. Er det ikke noget du kan klare? Det er ikke svært teknisk, men omhandler film/tv... Ca. 200-500 ord per artikel.. samt nogle mindre sætninger.
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I'm looking for a graphic designer to create a design for a glass film. The design should consist of colored squares arranged in a geometric pattern. Key requirements: - The use of squares as the dominant geometric shape - Modern, clean and visually appealing aesthetics The color scheme for the squares will be open for discussion, as I have not yet decided on a specific scheme. Ideally, you would be able to suggest a suitable color palette based on your understanding of design trends and color theory. The perfect freelancer for this project would be someone with: - A strong background in graphic design, particularly in creating designs for glass films or similar surfaces - A good understanding ...
...audio samples as we are developing a cutting-edge text-to-speech model. This exciting role requires producing 3 hours of clear, well-recorded voice samples, adhering strictly to our technical and quality guidelines. Essential Requirements: 1. Recording Format: 48 kHz in Mono audio format. 2. Frequency: Ensure a minimum of 20 kHz. Recordings below this will be rejected. Your microphone and software must meet this requirement. (Please review the attached image below. Ensure you self-check the audio quality using the Ocenaudio app. Share a screenshot of your audio analysis.) 3. Sound Quality: Audio must have NIL echo and be completely free from background noise or music. 4. Clipping: No instances of hard or soft clipping. (Include ...
...audio samples as we are developing a cutting-edge text-to-speech model. This exciting role requires producing 3 hours of clear, well-recorded voice samples, adhering strictly to our technical and quality guidelines. Essential Requirements: 1. Recording Format: 48 kHz in Mono audio format. 2. Frequency: Ensure a minimum of 20 kHz. Recordings below this will be rejected. Your microphone and software must meet this requirement. (Please review the attached image below. Ensure you self-check the audio quality using the Ocenaudio app. Share a screenshot of your audio analysis.) 3. Sound Quality: Audio must have NIL echo and be completely free from background noise or music. 4. Clipping: No instances of hard or soft clipping. (Include ...
...audio samples as we are developing a cutting-edge text-to-speech model. This exciting role requires producing 3 hours of clear, well-recorded voice samples, adhering strictly to our technical and quality guidelines. Essential Requirements: 1. Recording Format: 48 kHz in Mono audio format. 2. Frequency: Ensure a minimum of 20 kHz. Recordings below this will be rejected. Your microphone and software must meet this requirement. (Please review the attached image below. Ensure you self-check the audio quality using the Ocenaudio app. Share a screenshot of your audio analysis.) 3. Sound Quality: Audio must have NIL echo and be completely free from background noise or music. 4. Clipping: No instances of hard or soft clipping. (Include ...
...audio samples as we are developing a cutting-edge text-to-speech model. This exciting role requires producing 3 hours of clear, well-recorded voice samples, adhering strictly to our technical and quality guidelines. Essential Requirements: 1. Recording Format: 48 kHz in Mono audio format. 2. Frequency: Ensure a minimum of 20 kHz. Recordings below this will be rejected. Your microphone and software must meet this requirement. (Please review the attached image below. Ensure you self-check the audio quality using the Ocenaudio app. Share a screenshot of your audio analysis.) 3. Sound Quality: Audio must have NIL echo and be completely free from background noise or music. 4. Clipping: No instances of hard or soft clipping. (Include ...
...audio samples as we are developing a cutting-edge text-to-speech model. This exciting role requires producing 3 hours of clear, well-recorded voice samples, adhering strictly to our technical and quality guidelines. Essential Requirements: 1. Recording Format: 48 kHz in Mono audio format. 2. Frequency: Ensure a minimum of 20 kHz. Recordings below this will be rejected. Your microphone and software must meet this requirement. (Please review the attached image below. Ensure you self-check the audio quality using the Ocenaudio app. Share a screenshot of your audio analysis.) 3. Sound Quality: Audio must have NIL echo and be completely free from background noise or music. 4. Clipping: No instances of hard or soft clipping. (Include ...
...audio samples as we are developing a cutting-edge text-to-speech model. This exciting role requires producing 3 hours of clear, well-recorded voice samples, adhering strictly to our technical and quality guidelines. Essential Requirements: 1. Recording Format: 48 kHz in Mono audio format. 2. Frequency: Ensure a minimum of 20 kHz. Recordings below this will be rejected. Your microphone and software must meet this requirement. (Please review the attached image below. Ensure you self-check the audio quality using the Ocenaudio app. Share a screenshot of your audio analysis.) 3. Sound Quality: Audio must have NIL echo and be completely free from background noise or music. 4. Clipping: No instances of hard or soft clipping. (Include ...
...We are seeking a Post-Production Specialist to join our team in finalizing animated film projects. ? Here is the example of the animation that we prefer: . Video length: 5-10minutes. Frequency: 6-7 videos/week. Target: 25 years old and older. You will be responsible for editing visuals, adding special effects, synchronizing audio, and ensuring the final product meets the highest quality standards. Requirements: - Proficiency in post-production software such as Adobe Premiere, After Effects, or equivalents. - Experience in video editing, visual effects, and sound editing. - Creative mindset, attention to detail, and strong teamwork skills. - Time management skills and ability to meet project deadlines. Benefits: - Attractive salary and bonus in a cre...
I'm looking for a freelancer to design and develop a dynamic e-commerce platform for my services. This website should cater to customers looking to purchase services online. Key Features: - The site should have a section for customer reviews. This is crucial as it will enhance the site's credibility and encourage customer interaction. Ideal Skills: - Proficiency in e-commerce web development. - Strong understanding of UI/UX design principles. - Experience implementing customer review systems on e-commerce platforms.
...between 10 AM and 7 PM EST. Compensation $2–5/hour Job Description We are looking for a reliable and detail-oriented Virtual Assistant to manage scheduling and booking requests for our music and tutoring business. The ideal candidate will have excellent organizational skills, strong communication abilities, and the initiative to handle tasks independently. Responsibilities: Daily Tasks Check and respond to booking requests. Update and maintain the calendar with confirmed appointments. Send appointment reminders to clients. Handle rescheduling or cancellations promptly. Weekly Tasks Review the upcoming week’s schedule for conflicts or gaps. Prioritize bookings for high-value clients. Provide a summary of all scheduled sessions and pending re...
...developer to create a full scale e-commerce site for selling physical products. The site should come with an admin panel and domain setup. Key Features: - Shopping Cart: A seamless shopping cart experience is essential. - Product Search: The site should have a robust product search feature. - Customer Reviews: I want to incorporate a customer review system for products. Payment Integration: The site needs to support various payment methods. This includes Credit/Debit Cards, PayPal, and Bank Transfers. Ideal Skills: - Proficiency with Mern stack - Prior experience in e-commerce site development - Knowledge of secure payment integration - Understanding of customer review systems - Ability to set up a domain and an admin pan...
I need assistance with cleaning data from several digital Excel files. Key Responsibilities: - Review and clean data in Excel spreadsheets - Ensure data integrity and accuracy Ideal Candidate: - Proficient in Excel - Has experience with data cleaning - Detail-oriented and able to spot errors in data
I'm looking for an experienced 3D animator who specializes in creating realistic character anima...experienced 3D animator who specializes in creating realistic character animations. The animation will be part of a short film, so the ability to craft fluid, expressive and believable character movements is crucial. Key Requirements: - Extensive experience in 3D character animation - Proficient in creating realistic animations - Able to work within a film production timeline - Excellent understanding of storytelling through animation I would prefer someone who can provide a portfolio of previous similar work, ideally animations intended for short films or feature length movies. Your ability to create compelling character animatio...
...between 10 AM and 7 PM EST. Compensation $2–5/hour Job Description We are looking for a reliable and detail-oriented Virtual Assistant to manage scheduling and booking requests for our music and tutoring business. The ideal candidate will have excellent organizational skills, strong communication abilities, and the initiative to handle tasks independently. Responsibilities: Daily Tasks Check and respond to booking requests. Update and maintain the calendar with confirmed appointments. Send appointment reminders to clients. Handle rescheduling or cancellations promptly. Weekly Tasks Review the upcoming week’s schedule for conflicts or gaps. Prioritize bookings for high-value clients. Provide a summary of all scheduled sessions and pending re...
I'm looking for a talented videographer based in Dubai to help create a corporate documentary-style film for my company. The documentary will primarily include employee interviews, showcasing our team and the company culture. Videos will be like moses the jeweler post on youtube Key aspects of the project: - Filming primarily at our Dubai office - Conducting and filming employee interviews - Collaborating with our team to capture the essence of our company Ideal candidates should have: - Extensive experience in corporate videography - Expertise in documentary-style filming - Excellent sound and video editing skills - Ability to work with our team and capture candid moments - Good interpersonal skills for conducting interviews Please include sampl...
I'm seeking a highly skilled 3D artist to create a realistic, high-detail, textured space character for an animation film. Key Requirements: - Expertise in creating realistic 3D models - High proficiency in texturing and detailing - Prior experience in creating models for animation films - Ability to understand and follow a specific style guide - Strong portfolio showcasing similar work Please share your relevant work samples and your proposed timeline for this project.
...for a Wix expert to help me build a simple, engaging community website for bridge enthusiasts. Ideally, this person would meet with me via zoom to collaborate on projects. I also would like to learn how Wix works by watching you develop these projects. Ultimately, I want to be able to make simple changes myself. I have minimally started my site but it is not yet published. I would need you to review what I have done and move forward from there. Here are some things I have in mind: (1) I have created a chatbot on that I want to connect to the website (2) I want two levels of membership-paid and free so when a member signs in, they will go to the "free member page or the paid member page" (3) there will be "chat lounges" ...