Economics of innovation and new technology journalJobs
...are Wordpress based / Editable in the backend of the site Fast in google page speed insights Goal is under 2 seconds on all pages WP rocket + CACHING + MINIMISE PICTURES Features Videos Picture slides Animation videos Editable text Editable pictures Editable blocks Editable logos Create unique URLS - SEO wise Design wishes 14 different logos containing the name of each “BRAND name” FIGMA only / UX optimizing just like on FIGMA project Requirements WORDPRESS BASED Able to connect up with our DIV - contact formular on - FROM OUR BACKEND DEVELOPER (RoR Ruby On Rails) It should always be possible to load external JS as the current one is based on, so I don't think they can make something that won't work with the type of solution we use at th...
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq":"0","channel":"main-w-chan51-8888-react_uzonmseebkkzidac-MRb2","channelHash"...keys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You can test her...
Please, check th...the picture with number, the costumer can choose what part he need and add directly to shooping cart - the list of parts showing, you can see: Position, Stock Code (I do not need this one), Product Name, Pack Qty( I do no need this one), Price, Quantity and Total - you can choose differents products and "add to Cart" with only one click. - I expect you code what I want using "Pages" and "Static Blocks" of magento 1.6. This must be replicable. TOGETHER WITH THE QUOTE, I WILL ANSWER ONLY WHO SEND ME A DESCRIPTION HOW YOU PLAN TO DO THE CODE BE WORKING IN MAGENTO 1.6. IF YOU ARE EXPERT IN MAGENTO AND CAN HAND THIS JOB, GIVE ME A QUOTE. I WILL GIVE ACCESS TO MY WEBSITE, JUST AFTER YOU ACCEPT...
A new hosting company is arising from Scandinavia, and are looking for a Lead Designer who can control and engage in the Wordpress theme setup and functional design. The Website is supposed to be multilangual, by using WPML, and the control panel for the Hosting services is supposed to be build into Wordpress. For the sake of this, the designer will be required to think outside the box, and be able to work from a framework-thinking. The Wordpress tool WHMCS is not part of the project. Find ideas from:
We must have set up a new webshop like this here Webshop should have about 40 products, so it is a small webshop
Programmable timer unit with web UI for commercial application, such as school, factory etc. Hardware is ready. Only requires Firmware programmer in C ++ and with embedded web technology for user interface, to set or program the unit
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs.. after 19 hrs..
best price project best price xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Ideen er at skabe et website/en app, der kan benyttes af alle, når de vil og hvor de vil. Jeg har haft ideen i 15 år, nu kan jeg se at den er evig aktuel og kan udbygges med dette værktøj, men jeg kan ikke selv lave tingene/programmere. Det har potentiale; jeg ved det, da jeg sidder her med alle mulighederne skrevet ned. Jeg er selv freelancer: Sygepleje/psykote...potentiale; jeg ved det, da jeg sidder her med alle mulighederne skrevet ned. Jeg er selv freelancer: Sygepleje/psykoterapi/forfatter. Jeg har brug for en samarbejdspartner; jeg har ideen, og partneren kan programmere - vi deler 50/50. Dette har jeg fået at vide, af en anden iværksætter, er en helt almindelig fremgangsmå skal laves en fortrolighedsaftale inden jeg fortæller p...
Hi I own three sites: , & I need you to copy the template and content of from one webhotel to another, and upload it to roliga-skamt.se. Then, I need you to replace content and texts from with content and subpages from sjove-jokes.dk. In short, i need: 1. Copy site from to new webhotel (from to ) and upload to site 2. Replace content from Sjove-citater with content from sjove-jokes (less than 20 sub sites) 3. Create new header and a new simple logo for favicon 4. Same setup as with the mobile responsiveness Give me a fair offer. Best
poster for online posts 3 pictures Bold
blog posting like SEO,DESIGNING,SOCIAL MEDIA,TECHNOLOGY
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' Move website to new domain. Same website host'
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' New logo for my shop'
Jeg har hjemmesiden kropstart.dk. Der er til siden designet en funktion hvor jeg som admin kan lave færdige træningsprogrammer til brugerne på siden. Denne feature er lavet i HTML/ASP med JavaScripts og skal nu implementeres på hjemmesiden. Siden kører i WordPress og der skal laves en nem side i WordPress backend til at administrere og oprette træningsprogrammer ud fra de øvelser som findes på siden.
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
...skilled and experienced professional or team to assist in the development of a new medical aesthetic device. Device Purpose: The device will serve multiple purposes including: - Skin rejuvenation - Body contouring - Lipo suction - Fat dissolving Technology: The device will utilize laser technology. Ideal Skills and Experience: - Expertise in medical device development - Experience with laser technology - Background in selling/ using aesthetic devices - Knowledge of the UK medical device market - Understanding of regulatory requirements for medical devices in the UK The ultimate goal is to sell the device to medical professionals who are practising in the UK. The device is not only effective but also safe and comp...
...company, 2Ks Woodworking. A unique aspect of the design will be the inclusion of a backwards 'K' in '2Ks Woodworking' and a Japanese maple tree, or an element related to the tree. My woodworking shop incorporates technology specifically laser cutting wood, using CNC machines to cut wood, along with traditional tools such as table saw, band saw, and miter saw. Key Requirements: - The logo should be simple yet memorable, easy to understand and visually striking. - It should be versatile, working well in different sizes and across various applications, from my website to social media and print. - The design must be relevant, reflecting the brand's woodworking focus and appealing to its target aud...
I'm looking to have a physical, elegantly designed daily journal created for me. This journal should track my spending, income, and savings goals. Specifically, I need a planner that: - Adopts an elegant and classic style. - Incorporates three specific financial categories: a spending tracker, an income tracker, and savings goals. Ideal skills for this job would include: - Graphic design skills, to create an aesthetically pleasing and functional layout. - Experience with planner/journal design would be a plus. - Understanding of financial tracking and goal-setting. Please note, I want this to be a physical book, not a digital or printable one.
I'm looking for a freelancer who can help me articulate my business and industry. We need a concise and engaging description that covers the following: - A clear articulation of what our business is about, including our core values, purpose, and strategy. - A brief overview of the industry we operate in. Ideally, you would have experience in business writing and understand the nuances of the technology, healthcare, and retail industries.
I have 14 PDF files (7 mockups of a medicine box and 7 corresponding artworks) that need some layout changes. These alterations include repositioning, resizing, and adding or removing elements. All new design elements are ready and will be provided. Ideal Skills and Experience: - Proficiency in graphic design software - Prior experience with layout modifications - Attention to detail for design consistency - Ability to meet deadlines
