Daily open breakout mq4Jobs

...hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting aalborg hvad er et webhotel hvad er webhotel linux hosting open source webshop server hosting danmark start webshop virtual hosting vps hosting danmark web design wordpress theme webbureau webdesign webdesign cms webdesign aalborg webhotel webhotel billigt webhotel danmark webhotel gratis webhotel hosting webhotel priser webshop design webshop løsning webshop system webshop til salg website design using wordpress website design wordpress...

...hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting aalborg hvad er et webhotel hvad er webhotel linux hosting open source webshop server hosting danmark start webshop virtual hosting vps hosting danmark web design wordpress theme webbureau webdesign webdesign cms webdesign aalborg webhotel webhotel billigt webhotel danmark webhotel gratis webhotel hosting webhotel priser webshop design webshop løsning webshop system webshop til salg website design using wordpress website design wordpress...

gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

i want install ngenx mod ..........................................................................................................................................

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

fsdfsdddddddderterterrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrdddddddddddddddddddddddddddddddddd

Mit navn er Jonas og jeg er Webudvikler med mere end 7 års erfaring i branchen. * Primært fokus er Webudvikling (HTML/CSS, PHP, MySQL, JavaScript) * WordPress ekspert * Gennemtænkte løsninger, så du undgår unødvendig langtrukne projekter og ekstraarbejde * Kort leverings- og responstid (Haste opgaver er intet problem) * Kompetent rådgivning er vigtigere end øget salg (også selvom man er sælger)

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

NEED programmer ......................................................................00000000000000000000000000000000000000000000000000

jeanpierrejesses09 skype add me thanks xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

...are triggered in one hour graph giving an blue arrow at the open of the candle and a blue arrow face down at the top of the closing candle  Short explanation of the algo process The algo is working with 3 graphs (1H,15,5)that should be connected.  After position triggered in 1H an listing process in 15 minutes graph is starting,  When the position is opened it will mark the candle that opens the position also with a blue candle facing up at the open of the candle. All the marks (listening process,openposition,stoploss,takeprofits,closingposi tion) will also be shown in15- 5 minutes graph  process-black circle dot 2.openposition- blue arrow face up at the open candle loss- black triangular face down at the open of the candle...

I need a letter demanding compensation for the challenges I faced and which I will continue to face for the next 10 years. They open up a claim which is fraudulent and took money out of my bank account. I never applied for a loan. I need this financial company to delete this account from my credit report and compensation for my losses and the stress and anxiety I am having. I am under doctor's care.

As a small manufacturer, we're in need of a proficient Microsoft Access expert to design an inventory database for us. The primary purpose of this database is to track our inventory levels, taking into account incoming and outgoing shipments. This data will be updated daily. Key Database Features: - Tracking of item names and quantities - Management of supplier information - Monitoring of shipping details Ideal candidates should have prior experience in developing inventory databases, particularly with Microsoft Access. They should possess strong skills in database management, data analysis, and software development. Familiarity with manufacturing processes and supply chain logistics would be an added advantage.

I'm looking for an Excel expert to create a variable tracking Excel file for me. I will be inputting a list of 1000 or more 3-digit numbers (ranging from 1-5) like 123, 231, 542, etc. Key Requirements: - Track the movement of each digit (whether it's +1,2,3, or 4 or -1,2,3,4, and also 0 when the number remains the same in the next sequence). - Provide a tally of movements for each ...comprehensible manner. - Please use standard formatting for the summary table, no need for conditional or custom formatting. Ideal Skills & Experience: - Proficient in Excel, with experience in creating complex tracking files. - Previous experience with data analysis and reporting. - Excellent attention to detail, to ensure accurate tracking and reporting. The list of numbers will ...

My Flutter app is currently prompting to select a Google account every time I attempt to open a PDF from Google Drive. This is a minor issue, and I'm looking for a freelancer who can fix this promptly. Key Requirements: - A thorough understanding of Flutter, specifically the stable version. - Experience with the Google Sign-In library. - Ability to troubleshoot and resolve issues efficiently. Please note, this is a small task and I have set a fixed amount for this requirement. Bids are welcome only from freelancers who are comfortable with this.

...to repurpose content effectively across platforms Strong analytical skills to track and improve content performance Success Metrics: Increased engagement, followers, and LinkedIn inbound opportunities Higher Substack subscriptions from LinkedIn traffic Attracting recruiters, job seekers, and consulting leads Efficient LinkedIn growth while keeping my involvement to 5 hours per week Budget: Open to proposals (please include your rates and relevant experience). How to Apply: Submit a proposal with: A summary of your experience in LinkedIn content strategy and brand growth Examples of LinkedIn posts you’ve created or managed A brief outline of your strategy for growing my LinkedIn brand Your pricing & estimated weekly hours required I’m looking forward t...

...for mobile devices, specifically targeting productivity enhancement. The system integrates task management, time tracking, collaborative tools, and AI-powered analytics to optimize user workflows and improve task execution efficiency. Background of the Invention: With the growing dependence on mobile devices, professionals and individuals increasingly rely on mobile applications to manage their daily tasks. However, existing solutions often lack comprehensive integration of task scheduling, collaboration, and performance insights. Users typically switch between multiple applications, leading to inefficiencies, data fragmentation, and reduced productivity. This invention seeks to address these challenges by providing a unified platform that combines essential productivity tools w...

We are looking for an experienced SEO expert to optimize our articles for better ranking on search engines and drive organic traffic at an affordable price. The goal ...Competitor Analysis – Analyze top-ranking articles and implement strategies ✅ Content Optimization – Improve readability, structure, and engagement ✅ Monthly Reporting – Provide insights and progress updates Expectations: ? Must follow Google SEO guidelines (no black-hat techniques) ? Help us achieve better rankings & organic traffic growth ? Work within a budget-friendly price range ? Budget: Open to reasonable proposals ? Duration: Ongoing (long-term collaboration preferred) ? Interested? Send your portfolio and pricing details! You can tweak this as per your needs. Let me know if you wan...

...capable of creating and automating one new YouTube video daily, focused on celebrity news. The content should be engaging, suitable for an entertainment-oriented audience. I would like the thumbnail included. Key Requirements: - The video should primarily consist of video clips related to the topic and interview footage. - Experience in video editing and content automation is crucial. - A solid understanding of the celebrity news landscape is preferred. - An awareness that this is 1 video per day or 30 videos per month. I am hoping for a long-term partnership. Bidding and then asking about the project will result in immediate rejection. Read it first! Please note, this project requires the ability to consistently deliver content on a daily basis, so reliability and ...

I will research and compile a list of high-quality YouTube channels in the niches of Travel, Education, Gaming, Science, and Lifestyle According to the terms and conditions discussed in details and agreed by both of us in the chat i.e i will try to deliver at least 100 contacts daily and 600 weekly ..after each 200 contacts completion a payment milestone @ 5 INR/contact will be released , i will complete the required 1000 leads in the specified time..Thank you

...ways with both new and old, restoring application of ancient wisdoms from dropping more recent misunderstanding of their application - aligning our actions to mercy as definition of loving regard for that which we all depend on, in humility - possibly permitting enjoyment in the working out of this vision to carry additional benefit in the scope of the personal lives of participants and beyond - open to inclusion of those beyond initial respondants in order to carry the project's vision and whatever good develops within it and so on beyond the immediacy of any of us as individuals, good function and arrangement permitting, and as direction comes highest to lowest for each of us to bring to incorporate together - as at will, most full awarenesses together minded, ideally, eac...

...educational blog posts. The design should be clean, with a pastel style. It should be easy to edit the text over the image for different blog posts. We're looking for an educational theme. This could include faded educational objects in the background or something in the foreground. For colors, a background in blue/light blue could work well as this is similar to our site colors. However, we are open to different ideas and different colors/illustrations could be better depending upon the topic. Key Requirements: - Design a professional, clean, pastel-style Canva template - Incorporate a placeholder for the blog title - The template should be easy to use and modify for future posts Ideal Candidate: - Proficient in Canva - Experience in creating clean, professional design ...

I need a skilled app developer to create a mobile application for both iOS and Android. The specifics regarding the app's purpose and functionality have not been finalized yet, so I am open to suggestions and creative input from the developer. Ideal Skills and Experience: - Extensive experience in iOS and Android app development - Proficiency in cross-platform development tools - Strong understanding of UI/UX principles - Excellent problem-solving skills - Ability to work collaboratively and communicate effectively - Experience with E-commerce, Social Networking, or Entertainment apps would be a plus

My older WordPress theme, Eventerra, requires an update to its WooCommerce templates. The current version is outdated and causing issues with WordPress. Here are the specifics: - Two templates need to be updated: and pagination.php. - Minor tweaks are required t...flag them as outdated. Ideal Skills and Experience: - Proficient in WooCommerce and WordPress. - Experience working with the Eventerra theme. - Knowledge of PHP, HTML, CSS and JavaScript. - Ability to troubleshoot and resolve issues efficiently. - Capable of making minor adjustments to layout, styling, and functionality as necessary. This project does not require a complete redesign, but I am open to suggestions if you see areas for improvement. Please provide professional advice on the best course of action.

I'm looking for a budget-friendly expert to redesign my Shopify store. We sell high-end hair care products in the Indian marketplace and our current store, created using a basic theme, is in need of a ...Enhancing visual appeal: The store should be aesthetically pleasing and reflect our high-end brand. The ideal freelancer for this project would be someone who has: - Proven experience with Shopify store design and redesign. - A strong portfolio that demonstrates an ability to create luxurious, high-end designs. - Skills in improving user experience and increasing sales conversions through design. I am open to suggestions regarding specific areas of user experience that could be improved, but I would like to focus on creating a store that is visually aligned with a luxurious, ...

I'm looking to incorporate a facial recognition system into my advertisements. The preferred technology for this project is Amazon Rekognition. Ideal skills for this project include: - Proficiency in Amazon Rekognition - Experience in integrating facial recognition systems into ads - Knowledge in digital marketing strate...into my advertisements. The preferred technology for this project is Amazon Rekognition. Ideal skills for this project include: - Proficiency in Amazon Rekognition - Experience in integrating facial recognition systems into ads - Knowledge in digital marketing strategies Please note that the specifics of the ad type and the actions to be taken upon face recognition will be discussed later. I'm open to suggestions on how to best utilize this technology...

I'm seeking a seasoned Go tutor with industrial exp...tutor with industrial experience who can guide me on how to contribute effectively to open source projects, with a specific focus on code contributions. Looking for daily 1-2 hours for 10 days. My current level of proficiency with Go is Beginner. The guidance format should include live sessions. I can dedicate 7-10 hours per week to tutoring sessions. I have specific open source projects in mind. I would also like assistance with code reviews from the tutor. I expect high involvement from the tutor in helping with my contributions to the specific open source projects. Please assist with setting up my development environment to ensure smooth contributions. I do not require help selecting the specific ...

I'm in need of a talented individual to capture both photos and videos of cars related details and role will also involve editing these clips and images to create a dramatic and cinematic final product. Key Requirements: - Own...clips and images to create a dramatic and cinematic final product. Key Requirements: - Own high-quality shooting and editing equipment (DSLR or mirrorless cameras, Laptop, wide-angle lenses, drones, etc.) - Proven experience in car photography and videography - Exceptional editing skills - Passionate freelancer or college student, ideally based in Ambala or nearby, able to come to the studio daily Please submit your portfolio or sample work if you fit this description and are interested. I look forward to collaborating with a creative professional...

... leveraging cutting-edge voice and video agent technology. About LiveKit LiveKit empowers developers to rapidly deploy voice and video agents within their applications. Built with Open Source SDKs and running on LiveKit's real-time global infrastructure, LiveKit enables: - Natural AI Conversations: Create AI agents that interact seamlessly in natural language. - Flexible AI Design: Integrate voice-to-voice AI with leading models from OpenAI, Cartesia, Deepgram, ElevenLabs, and Google. - Low Latency and Scalability: Deliver ultra-low latency experiences across desktop, mobile, and telephone platforms. - Open Source Standards: Built on the LiveKit Agents framework, supporting WebRTC for real-time inference. - Rapid Deployment: Launch quickly and scale effortlessly wi...

... triggered in one hour graph giving an blue arrow at the open of the candle and a blue arrow face down at the top of the closing candle Short explanation of the algo process The algo is working with 3 graphs (1H,15,5)that should be connected. After position triggered in 1H an listing process in 15 minutes graph is starting, When the position is opened it will mark the candle that opens the position also with a blue candle facing up at the open of the candle. All the marks (listening process,openposition,stoploss,takeprofits,closingposition) will also be shown in15- 5 minutes graph process-black circle dot 2.openposition- blue arrow face up at the open candle loss- black triangular face down at the open of the candle profits-circle dot, posi...

I'm seeking a designer to create a traditional-style family coat of arms. The design should capture the essence of traditional heraldry. Ideal skills and experience for the job include: - Strong background in graphic design, specifically in creating traditiona...family coat of arms. The design should capture the essence of traditional heraldry. Ideal skills and experience for the job include: - Strong background in graphic design, specifically in creating traditional designs - Familiarity with heraldic symbols and styles - Ability to create a design that is both unique and reflective of a classic coat of arms While I am not sure about specific colors, I am open to your professional suggestions and insights. Please, feel free to incorporate a color scheme that you feel fits t...

I'm running a digital marketing agency, and I need a Sales Representative to help with daily outreach and appointment setting for highly qualified leads. The ideal candidate will engage prospects via email, LinkedIn, Facebook, and Instagram to generate appointments with small business owners. Core Responsibilities: - Send a minimum of 1,500 emails per day using GoDaddy, HubSpot, , and Instantly - Conduct direct outreach on LinkedIn, Facebook, and Instagram - Set a minimum of 1 appointment per day through Calendly Position Details: - Pay: $7 USD/hour - Hours: Max 3 hours/day - 3 days/week - Remote Position Ideal candidates should have experience in email marketing, lead generation, and CRM tools. If you’re a results-driven sales professional focused on generating appoi...

I'm in need of a seasoned professional with expertise in C, C++, and Python, alongside a deep understanding of telecommunications, to develop software capable of receiving SMS and calls. This software should be compatible with the 4G and 5G networks of Provider A, Provider B, and Provider C in a specific country. ...purposes. - Strong knowledge and experience with SS7, HTTP/2, and Diameter signalling. - Software compatibility with both Windows and Ubuntu operating systems. - Adherence to recognized telecommunications security practices throughout the development process. The ideal candidate for this project will be a strong developer with extensive experience in telecommunications software development. I'm open to ideas and advice, but I require the most experienced indi...

Vær venlig at Tilmelde dig eller Log ind for at se detaljer.

Need a skilled 3D graphic designer/animator to create a lifelike animation sequence involving balloons and their deployment in a swarm. The sequence includes: 1) Components of a balloon being placed in a box, programmed to deploy from 25 boxes on pickup trucks into the field. 2) Buttons pressed to auto-open boxes, with balloons inflating and attaching drone-like propellers, a black box with instruments, and a hydrogen fuel cell. 3) An under-hanging hydrogen cylinder. 4) Sequence showing balloons rising into the sky in formation, featuring one queen balloon, then exchanging hydrogen cylinders and returning to position. 5) Final visual of four balloons high at 100m apart vertically, then changing to twelve balloons vertically followed by twelve horizontally. Must be done in realistic ...

I'm in search of a 3D video editor who's proficient in Blender to create a captivating 3D animated cartoon video featuring animal characters. Project Details: ✅ Video Length: 3 to 4 minutes ✅ Deadline: 1 week ✅ Style: 3D animated car...Video Length: 3 to 4 minutes ✅ Deadline: 1 week ✅ Style: 3D animated cartoon focusing on everyday life lessons ✅ Software: Blender (or similar tools for 3D animation) Requirements: ? Extensive experience in 3D animation & video editing ? Expertise in character animation ? Exceptional ability to create engaging and kid-friendly cartoon content ? Efficient workflow to meet deadlines ? Budget: Open to discussion based on experience & quality If you're interested, drop your portfolio and pricing in the comments or DM me! Let&...

Promote My Private Facebook Group in Targeted Online Communities Description: I’ve just created a new private Facebook group for daily deals, and I need someone to help me grow my audience! I’m looking for someone who can share the link in relevant online communities where my target audience is likely to be—women aged 30+, especially moms, but not exclusively. Job Requirements: Post about my group in private Facebook groups, subreddits, and other online communities where women aged 30+ or moms gather. Ensure posts are shared in places where my target audience will see and engage with them. The goal is to drive people to join the group, so the post should be enticing, friendly, and focused on the value of the deals in the group. Ideal Candidate: Experience in p...

I'm seeking a developer who can create an Edge Function in Supabase for user management, as well as a system for daily push notifications. Key Requirements: - Create an Edge Function that deletes users based on manual selection. - Set up a system that sends push notifications every evening. The notifications should primarily contain reminders. - Utilize a Supabase database in conjunction with One Signal and Flutterflow for both Apple and Android platforms. Ideal Skills: - Proficiency in Supabase and Edge Functions. - Experience with One Signal and Flutterflow. - Knowledge in setting up cross-platform push notifications.

As a client, I am in need of a seasoned perfumer who can create a diverse selection of unique and captivating fragrances for my perfume business. I am open to a range of scent profiles, including floral, citrus, and woody fragrances. Key Responsibilities: - Develop over 7 unique fragrances - Provide creative input and suggestions for fragrance types and ingredients - Perform extensive scent testing and evaluations to ensure high-quality fragrances. Ideal Candidate: - Professional perfumer with significant experience - In-depth knowledge of various fragrance ingredients and notes - High level of creativity and innovation - Excellent communication skills to understand and fulfill my requirements The target market for the fragrances is the luxury market.

Freelance ASL Expert for Motion Capture Accuracy R...animation is a plus but not required. - Ability to articulate clear feedback on signing accuracy and legibility in real-time. Project Details: - Scope: Review a set of short motion capture clips (several clips, each 5-10 seconds long). - Format: Live call-based review (not just written feedback). - Purpose: Ensuring ASL motion capture results are accurate, readable, and understandable. - Compensation: Open to discussion based on experience. How to Apply: If you're interested, please provide: - A brief overview of your experience with ASL and motion analysis. - Any relevant past work (video reviews, translations, educational content, etc.). - Your availability for a live call and rate for this project. Looking forward to wo...

My logo needs an update to a circular design with a unique, high-quality and elegant aesthetic. It's crucial that it stands out from the typical home improvement lo...elegant aesthetic. It's crucial that it stands out from the typical home improvement logos that feature a roof. You will have the freedom to incorporate other elements, beyond just a roof, into the design - tools, abstract shapes, or nature elements - as you see fit. Key requirements: - Exceptional graphic design skills - Experience in logo design - Ability to create a modern, elegant design - Open to creative, out-of-the-box ideas - Strong understanding of color theory and design principles Ultimately, I want a logo that not only communicates high quality and elegance but also sets us apart in the home i...

Vær venlig at Tilmelde dig eller Log ind for at se detaljer.

I'm looking for a freelancer who can download numerical data from a specific website and organize it in an Excel spreadsheet. The data is updated daily every 3 min, so this will be a regular task. Requirements: - Download and organize all available numerical data columns from the website into Excel. - This task needs to be done daily in sync with the website's updates. Ideal Skills: - Proficiency in Excel and web data extraction. - Attention to detail and ability to follow daily schedules.

...Handling Specialists. If you are passionate about making the online space safer and more respectful, this is a great opportunity for you! What You’ll Do: ✅ Handle and process content-related complaints on various social media platforms. ✅ Draft complaint reports in accordance with social media policies. ✅ Communicate effectively with the team to ensure timely resolutions. Who Can Apply? ✔ Open to fresh graduates and those with no prior experience. ✔ Individuals who understand social media platforms or are willing to learn. ✔ Detail-oriented, proactive, responsive, and able to follow guidelines. ✔ Available for long-term freelance work with flexible hours. Why Join Us? ? Work remotely from anywhere in Indonesia. ? Gain valuable experience in content moderation and o...

We a...and experience with relevant frameworks (e.g., React Native, Flutter, or others). • Proven experience in developing mobile applications for both Android and iOS. • Strong understanding of software architecture and algorithm design. • Familiarity with both back-end and front-end development. • Ability to work independently in a remote setting. Work Environment: • Remote working arrangement with daily check-ins with the Founder. • Flexible scheduling for 4 hours of dedicated work each day. What We Offer: • Opportunity to contribute to a pioneering EdTech platform in a niche domain. • Collaborative and innovative work environment. • Competitive compensation for part-time engagement. We’re excited to find a passionate develope...

Look , , What I Need: A high-quality landing page with an eye-catching and professional design. Built using the latest web technologies (**React, , Tailwind CSS, Framer ...sleek designs. Ability to build scalable and reusable components. Familiarity with animations (e.g., Framer Motion, GSAP) for a premium feel. Experience working with API integrations is a plus. This is the first phase of a larger project, and I'm looking for a long-term partnership. If you have the skills and passion to build something cutting-edge and visually stunning, let’s talk! Budget: Open to fair proposals based on experience. Drop your portfolio, previous work, and estimated timeframe for the landing page development. Let’s build something amazing together!

...influence on the final aggregated sentiment. - **Rolling Average**: Smooth out day-to-day fluctuations and highlight overall sentiment trends. 4. **Output Generation** - **CSV**: - Name: `` - Fields: `[date, headline, sentiment_score, source]` - Placed in `output/` folder. - **Graph**: - Line chart (e.g., **matplotlib** or **plotly**) showing daily average sentiment from `start_date` to `end_date`. - Name: `` (or `.svg`) - Placed in `output/` folder. 5. **Performance & Memory Constraints** - Keep total usage under **512 MB**: - Use streaming or partial reading for large data sets. - Offload large computations if needed or limit the article volume. - **CPU**: Max 4 vCPUs / 4 GB RAM ensures

...The design is provided in desktop format, but it should be configured to be responsive and adaptable to mobile and tablet devices. In the header, the logo will be an image, but the text “Encuestas” must be rendered as plain text. The links “Inicio” and “Mis proyectos” should point to #, as should the yellow eye icon. The icon and link “Ver código” should open a modal window similar to the one displayed on page 5. The publish button should open a modal similar to the second box on page 3 with the text “¿Está seguro de que desea publicar?” and two buttons, “Sí” and “No.” Both buttons should close the modal without taking any further action. The title field in the...

I need a professional to help me refine my self-made logo. The current color scheme might need some adjustments, but I'm open to other suggestions. It could include some nature-inspired elements into the design. Skills and experience that would be ideal for this job: - Proficiency in graphic design software - Experience with logo design - Ability to work with nature-inspired elements - Strong understanding of color theory and typography

I'm seeking a seasoned Google Ads Specialist to drive sales for my business. Key Responsibilities: - Set up, manage, and optimize Google Ads campaigns focused on the Search Network. - Prioritize specific services in the ad content. - Conduct thorough keyword research and implement effective PPC strategies. - Conduct daily reviews of ad performance and make necessary adjustments. Ideal Candidate: - Proven track record in PPC advertising with demonstrable past campaign results. - Expertise in conversion optimization. - Strong ability to maximize ROI. Please include your past campaign results and a brief outline of your strategy to help me increase sales.