City of destin building departmentJobs
Androidbuilder, mit app builder, kodular tools app building required
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq"...com","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You ca...
logo motorcycle club ( Riyadh Knights ) you can use the old city as background for the logo :1646203317462&source=lnms&tbm=isch&sa=X&ved=2ahUKEwivm9yf6ab2AhWNasAKHZpHDkQQ_AUoAnoECAIQBA&biw=1280&bih=569&dpr=1.5#imgrc=pCD1dfpVhjUsNM add a motorcycle , and shield to refer to the Knights something similar to the attached logo
We have two documents with URL's that needs to be scraped. The scripts is partly made, but have some flaws. Script 1 : We need to be able to scrape URL's like these: What we need of info is : * Name of restaurant * Adress * Postalnumber + city * URL So the data retrieved should be delivered in a csv file : "Den Gamle Grillbar og BBQ", "Holsteinsgade 12", "8300 Odder", " " "Marios Pizza", "Melstedvej 17", "2770 Kastrup", "" "Tobclas Sandwich", "Torvet 3", "8700 Horsens" ,""
I don't read autogenerated responses to my ad. So if you want to be considered in relation to this job, please give me a proper offer. I need help with link building. Links must be created to follow pages Keyword: meeting booking, meeting bookers, new customers Keyword: telemarketing Keyword: Sales manager, hire a sales manager, What can you offer? NoFollow and Folllow - PageRang!
The creation of a virtual office
help me build this website --> http://burgaardsjuletræ
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
I have my campaign
Database description Database to be run on Internet, with a small number of users, now 6 users. Login for each user, the database is not visible if you are not logged in. The database to be used for the creation and search of records. The information consists of standard personal data, address, and mail. Typing the postcode, the city name is found in an underlying base. Furthermore, there is the creation date / correction date 3 text fields and 2 dropdown field - and a note field. One drop down box shows the default login person (which is part of the drop down option) Searching is done on 3-4 fields individually, and results are displayed as list, which can be clicked on, as each result is displayed. The layout may be edit via CSS. The database ...
We already have a gallery in Aarhus Denmark and is in preparation for the opening of the dept . Number two in Hamburg .. There is in this project need Enthusiasts who can either sell through the Internet, Aarhus Dept. or open their own gallery in their city .. we would want such a scheme supporting the arts , counseling and support in all possible ways , we have the opportunity .. Ground Zero Organisation we are against your opening have certain criteria that must be met .. ----------------------------------------- Vi har allerede et Galleri i Aarhus Danmark og er i forberedelserne til åbningen af afd. nummer to i Hamborg.. Der er i dette projekt brug for Ildsjæle, som enten kan sælge via internettet, Aarhus afd eller åbne deres helt eget ga...
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
SEO SMO (FaceBook) Link Building Forum Posting Blog Posting
Link Building, SEO, Internet Marketing, Social Media Marketing, Market Research
...through manually link building, leads generation, social media marketing... The website is a architect company which targets Denmark area. On-page optimization has already been done. Only off-page SEO optimization is required to improve keyword ranking on Google. For anyone interested in this project, please submit a detailed proposal of how the keywords will be ranked and the techniques used. Full report of the work done must be submitted. All work has to be done manually using white-hat processes. -- Only white hat, experienced, highly ranked on freelancer.com SEO experts should bid -- Quality back links must relate to site topic on high quality relevant sites -- No black hat, gray hat or unethical SEO methods are to be used -- no junk profile ...
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Internet marketing, SEO, Link Building, Facebook marketing
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
Dear Indyainfo i want you to work 8 hours on my site, make it more SEO powerfull. remember link building. I made a list wil a lot of keywords. i just want to be on page 1 at as many as possible if you can do that. Hope to hear from you soon. bedste danske web hosting bedste gratis hosting bedste hosting bedste web hosting bedste webhotel billig domæne hosting billig email hosting billig hosting billig server hosting billig web hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting...
Dear Indyainfo i want you to work 8 hours on my site, make it more SEO powerfull. remember link building. I made a list wil a lot of keywords. i just want to be on page 1 at as many as possible if you can do that. Hope to hear from you soon. bedste danske web hosting bedste gratis hosting bedste hosting bedste web hosting bedste webhotel billig domæne hosting billig email hosting billig hosting billig server hosting billig web hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting...
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
We are seeking a skilled designer to create a Fiber to the Home (FTTH) network layout for a city using AutoCAD. The ideal candidate will have experience in telecommunications design and a strong understanding of FTTH architecture. You will work closely with our engineering team to ensure the design meets all necessary specifications. Proficiency in AutoCAD is essential, and familiarity with city planning and network infrastructure is a plus. Deliverables. 1) Autocad Design 2) Bill of Materials 3) Zone for each passive cabin 4) Route Path for each cable on Google Earth
I'm looking for a freelancer to create a stylised, cartoonish, digital drawing of three pugs and a German shepherd. The final piece will be intended for framing. Ideal Skills & Experience: - Proficient in digital illustration - Strong understanding of cartoonish drawing style - Experience creating pet portraits - Able to deliver high-quality, print-ready artwork
