City of destin building departmentJobs

Filtrér

Mine seneste søgninger
Filtrer ved:
Budget
til
til
til
Slags
Færdigheder
Sprog
    Job-status
    2,000 city of destin building department jobs fundet

    Androidbuilder, mit app builder, kodular tools app building required

    €3 / hr Average bid
    €3 / hr Gns Bud
    2 bud

    In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq"...com","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You ca...

    €41 Average bid
    €41 Gns Bud
    12 bud

    logo motorcycle club ( Riyadh Knights ) you can use the old city as background for the logo :1646203317462&source=lnms&tbm=isch&sa=X&ved=2ahUKEwivm9yf6ab2AhWNasAKHZpHDkQQ_AUoAnoECAIQBA&biw=1280&bih=569&dpr=1.5#imgrc=pCD1dfpVhjUsNM add a motorcycle , and shield to refer to the Knights something similar to the attached logo

    €26 Average bid
    €26 Gns Bud
    55 bud
    Scrape with Node.js
    Udløbet left

    We have two documents with URL's that needs to be scraped. The scripts is partly made, but have some flaws. Script 1 : We need to be able to scrape URL's like these: What we need of info is : * Name of restaurant * Adress * Postalnumber + city * URL So the data retrieved should be delivered in a csv file : "Den Gamle Grillbar og BBQ", "Holsteinsgade 12", "8300 Odder", " " "Marios Pizza", "Melstedvej 17", "2770 Kastrup", "" "Tobclas Sandwich", "Torvet 3", "8700 Horsens" ,""

    €190 Average bid
    €190 Gns Bud
    24 bud
    Link Building
    Udløbet left

    I don't read autogenerated responses to my ad. So if you want to be considered in relation to this job, please give me a proper offer. I need help with link building. Links must be created to follow pages Keyword: meeting booking, meeting bookers, new customers Keyword: telemarketing Keyword: Sales manager, hire a sales manager, What can you offer? NoFollow and Folllow - PageRang!

    €73 Average bid
    €73 Gns Bud
    16 bud

    The creation of a virtual office

    €160 Average bid
    €160 Gns Bud
    4 bud
    website building
    Udløbet left

    help me build this website --> http://burgaardsjuletræ

    €349 Average bid
    €349 Gns Bud
    23 bud

    Mindset building

    €15 Average bid
    €15 Gns Bud
    19 bud

    ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish

    €197 Average bid
    €197 Gns Bud
    4 bud

    Logo designing

    €73 Average bid
    €73 Gns Bud
    21 bud
    €12 / hr Gns Bud
    4 bud
    Build of models
    Udløbet left

    Autocad designing

    €274 Average bid
    €274 Gns Bud
    6 bud

    Database description Database to be run on Internet, with a small number of users, now 6 users. Login for each user, the database is not visible if you are not logged in. The database to be used for the creation and search of records. The information consists of standard personal data, address, and mail. Typing the postcode, the city name is found in an underlying base. Furthermore, there is the creation date / correction date 3 text fields and 2 dropdown field - and a note field. One drop down box shows the default login person (which is part of the drop down option) Searching is done on 3-4 fields individually, and results are displayed as list, which can be clicked on, as each result is displayed. The layout may be edit via CSS. The database ...

    €267 Average bid
    Fremhævet Haster
    €267 Gns Bud
    9 bud

    We already have a gallery in Aarhus Denmark and is in preparation for the opening of the dept . Number two in Hamburg .. There is in this project need Enthusiasts who can either sell through the Internet, Aarhus Dept. or open their own gallery in their city .. we would want such a scheme supporting the arts , counseling and support in all possible ways , we have the opportunity .. Ground Zero Organisation we are against your opening have certain criteria that must be met .. ----------------------------------------- Vi har allerede et Galleri i Aarhus Danmark og er i forberedelserne til åbningen af afd. nummer to i Hamborg.. Der er i dette projekt brug for Ildsjæle, som enten kan sælge via internettet, Aarhus afd eller åbne deres helt eget ga...

    €8 - €190628504558
    Fremhævet Haster
    €8 - €190628504558
    0 bud

    COPY OF AN ECOMMERCE SITE NEED My budget 30 usd

    €28 Average bid
    €28 Gns Bud
    2 bud

    Design A Catalog Of Products (1 Page)

    €18 Average bid
    €18 Gns Bud
    12 bud

    SEO SMO (FaceBook) Link Building Forum Posting Blog Posting

    €130 Average bid
    €130 Gns Bud
    3 bud

    Link Building, SEO, Internet Marketing, Social Media Marketing, Market Research

    €975 Average bid
    €975 Gns Bud
    1 bud
    €29 - €29
    0 bud
    Link Building
    Udløbet left

    ...through manually link building, leads generation, social media marketing... The website is a architect company which targets Denmark area. On-page optimization has already been done. Only off-page SEO optimization is required to improve keyword ranking on Google. For anyone interested in this project, please submit a detailed proposal of how the keywords will be ranked and the techniques used. Full report of the work done must be submitted. All work has to be done manually using white-hat processes. -- Only white hat, experienced, highly ranked on freelancer.com SEO experts should bid -- Quality back links must relate to site topic on high quality relevant sites -- No black hat, gray hat or unethical SEO methods are to be used -- no junk profile ...

    €288 Average bid
    €288 Gns Bud
    12 bud
    Social platform
    Udløbet left

    Building a social P2P platform for skills exchange

    €758 Average bid
    €758 Gns Bud
    1 bud

    /findtranscript/ error.. pls fix

    PHP
    €19 Average bid
    €19 Gns Bud
    17 bud

    poster for online posts 3 pictures Bold

    €21 Average bid
    €21 Gns Bud
    13 bud

    link building etc

    €49 Average bid
    €49 Gns Bud
    1 bud

    Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:

    €148 - €445
    €148 - €445
    0 bud

    seo, link building etc..

    €122 Average bid
    €122 Gns Bud
    1 bud
    SEO my Website
    Udløbet left

    Internet marketing, SEO, Link Building, Facebook marketing

    €82 Average bid
    €82 Gns Bud
    17 bud
    Modeling Building
    Udløbet left

    Modeling for render

    €122 - €122
    €122 - €122
    0 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'

    €24 / hr Average bid
    €24 / hr Gns Bud
    1 bud

    Dear Indyainfo i want you to work 8 hours on my site, make it more SEO powerfull. remember link building. I made a list wil a lot of keywords. i just want to be on page 1 at as many as possible if you can do that. Hope to hear from you soon. bedste danske web hosting bedste gratis hosting bedste hosting bedste web hosting bedste webhotel billig domæne hosting billig email hosting billig hosting billig server hosting billig web hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting...

    €10 / hr Average bid
    €10 / hr Gns Bud
    7 bud
    SEO for TInlap.com
    Udløbet left

    Dear Indyainfo i want you to work 8 hours on my site, make it more SEO powerfull. remember link building. I made a list wil a lot of keywords. i just want to be on page 1 at as many as possible if you can do that. Hope to hear from you soon. bedste danske web hosting bedste gratis hosting bedste hosting bedste web hosting bedste webhotel billig domæne hosting billig email hosting billig hosting billig server hosting billig web hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting...

    €8 / hr Average bid
    €8 / hr Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €18 - €148
    €18 - €148
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud
    PROJECT OF TYPING
    Udløbet left

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €106 Average bid
    €106 Gns Bud
    1 bud

    Tunne a linux server

    €146 - €146
    €146 - €146
    0 bud

    im looking for an estimate on creating a cad drawing of the ring that i uploaded

    €29 - €244
    €29 - €244
    0 bud
    Custom Project 440
    Udløbet left

    Link building etc

    €98 Average bid
    €98 Gns Bud
    1 bud
    Custom Project 438
    Udløbet left

    link building etc

    €54 Average bid
    €54 Gns Bud
    1 bud
    Custom Project 436
    Udløbet left

    Link Building etc

    €98 Average bid
    €98 Gns Bud
    1 bud
    Custom Project 434
    Udløbet left

    Link building etc

    €54 Average bid
    €54 Gns Bud
    1 bud

    As per skype conference

    €439 Average bid
    €439 Gns Bud
    1 bud

    Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...

    €390 Average bid
    €390 Gns Bud
    5 bud
    FTTH Design on Autocad
    6 dage left
    Godkendt

    We are seeking a skilled designer to create a Fiber to the Home (FTTH) network layout for a city using AutoCAD. The ideal candidate will have experience in telecommunications design and a strong understanding of FTTH architecture. You will work closely with our engineering team to ensure the design meets all necessary specifications. Proficiency in AutoCAD is essential, and familiarity with city planning and network infrastructure is a plus. Deliverables. 1) Autocad Design 2) Bill of Materials 3) Zone for each passive cabin 4) Route Path for each cable on Google Earth

    €29 - €244
    €29 - €244
    0 bud

    I'm looking for a freelancer to create a stylised, cartoonish, digital drawing of three pugs and a German shepherd. The final piece will be intended for framing. Ideal Skills & Experience: - Proficient in digital illustration - Strong understanding of cartoonish drawing style - Experience creating pet portraits - Able to deliver high-quality, print-ready artwork

    €74 Average bid
    €74 Gns Bud
    47 bud