Benefits of working for a fintechJobs
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq":"0","channel":"main-w-chan51-8888-react_uzonm..."broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You can test her...
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg sk...lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel De...
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
This project delves into the fascinating intersection of behavioral finance and data science. We aim to analyze ptivided data through the lens of investor psychology, identifying behavioral biases and sentiment drivers that influence market trends. Using R and statistical modeling, we will examine historical market data, news sentiment, and social media trends to develop predictive models of market movements. This project offers a unique opportunity to contribute to a cutting-edge research initiative with real-world applications in investment strategy and risk management. Key Deliverables: Quantitative analysis of market data and investor behavior. Development of predictive models incorporating behavioral finance insights. Comprehensive re...
I'm seeking a minimalist style WebM animation. The sequence should involve splashed poker chip stacks organizing neatly, then toppling over, before the loop restarts. The color scheme is bright and vivid, so it should pop and be visually engaging. Key Requirements: - Animation should have a minimalist design - Use of a bright and vivid color palette - Customization of the poker chips with my provided logo in the middle area Ideal Skills and Experience: - Proficient in creating WebM animations - Strong understanding of minimalist design principles - Experience with logo and pattern design on animated objects
My Digital Ocean droplet, which hosts a web application, has stopped responding after a restart. I suspect a network issue. It’s crucial to get this fixed ASAP. Ideal Skills: - Experience with Digital Ocean droplets - Networking troubleshooting - Web application hosting - Server management Please reach out if you can assist. Bid if you can start working immediately
...Thank you for taking the time to read my proposal. Please do not respond if you don’t want to work commission based! This project is no fixed fee project and you will have to do work before you start earning. It’s an investment in yourself. I am a full-time professional trader, having started my journey about five years ago. During this time, I’ve experienced both the pitfalls of scams and the benefits of working with genuine people who truly want to help others succeed. Prior to trading, I ran a small business, which I sold to fully dedicate myself to trading. Now, five years later, I am a consistently profitable trader, and I’ve gained a deep understanding of how the markets move and how t...
I am in the process of developing a custom HR system and my freelancer needs my assistance regarding tax regulations. I am looking for someone with expertise in both Australian and Philippine tax laws. Key Requirements: - Extensive knowledge of Employee income tax, Corporate tax, and GST/VAT in both Australia and the Philippines. - Ability to integrate tax calculations into various components of the HR system including Payroll processing, Employee benefits, and Expense reimbursements. - Previous experience working with HR systems is a plus. Your expertise will ensure that the HR system is compliant with both countries' tax regulations. Please include in your bid an outline of your experience with tax consulting and HR s...
I am working on a research project for AI-based early detection of congenital heart defects (CHDs) using a 12,000-labeled echocardiogram dataset. I need an experienced freelancer to completely build and train models using Convolutional Neural Networks (CNNs) and Generative Adversarial Networks (GANs) to achieve accurate and reliable results. The task involves: Preprocessing: Augmentation and cleaning of the dataset. Model Development: Building and training a GAN-CNN hybrid model for CHD detection. Validation: Testing and validating the model to generate results, including metrics like accuracy, sensitivity, and specificity. Deliverables: Fully functional code (Python/TensorFlow/Keras, Google Colab preferred). Final results and visua...
We are seeking an experienced content writer who is proficient in Indian languages (excluding Hindi) to create engaging content in the fields of insurance and fintech. The ideal candidate should have a strong understanding of these domains and be able to produce high-quality articles that resonate with our target audience. Ai or plagiarized content would be rejected. Process would be, I will share the topic and you need to share the layout first, post approval of layout, you need to submit the article within 24 hours. If you're passionate about writing and have expertise in these sectors, we want to hear from you! Kindly share your charges in the subject line Thank you
Hello dear readers, Thank you for taking the time to read my proposal. I am a full-time professional trader, having started my journey about five years ago. During this time, I’ve experienced both the pitfalls of scams and the benefits of working with genuine people who truly want to help others succeed. Prior to trading, I ran a small business, which I sold to fully dedicate myself to trading. Now, five years later, I am a consistently profitable trader, and I’ve gained a deep understanding of how the markets move and how to profit from them. My portfolio generates an average annual return of around 50%, with a strong focus on risk management. As an entrepreneur, I’m eager to ...
I want to develop an animated series which concen...develop an animated series which concentrates on "how to make India a developed country". Trailer: In 1700 India was holding 27% of world economy. 200 years later India's share dropped to less than 3%. Why? Because British came and demolished India's native institutions. 1) Its economy deindustrialized 2) Its trade networks got destroyed 3) Its people got deeply divided by caste and creed. In just 200years India was turned from richest country to developing country. It is 21st century, still we are said as a developing country. Here comes KALAM who tells us in each episode one idea how to turn India to a developed country. Hold on to watch more ..................trailer ends I need s...
I am seeking a talented creative writer with a knack for crafting captivating romance narratives. Your primary task will be to create engaging storylines that resonate with an adult audience. Ideal candidates should have: - Proven experience in creative storytelling, particularly in the romance genre. - Excellent command over the written word, with a flair for crafting compelling narratives. - Ability to understand and cater to an adult audience. Your creative storytelling will not only entertain but also draw readers into the beautiful complexities of love.
I am in need of a talented copywriter who can help me craft compelling product descriptions aimed at increasing sales. The target audience for these descriptions is the general consumer market, so the copy will need to be accessible, engaging, and persuasive to a wide array of potential customers. Ideal Skills and Experience: - Proven experience in copywriting, particularly in crafting product descriptions - Strong understanding of sales-oriented copy - Ability to write for a general consumer audience - Creativity and ability to think outside the box - Excellent command of the English language
...Development of a Loan Marketplace Mobile App (E-Hailing Model for Loans) Project Description: We are seeking an experienced and highly skilled app developer (or development team) to create a loan marketplace mobile app. The platform will connect loan seekers and lenders, facilitating short-term loans (1-2 months). The app should have a user-friendly interface, robust security features, and efficient matching algorithms to ensure seamless interactions. Think of it as an “Uber for loans,” but focused on financial transactions. If you have experience in building fintech applications, marketplaces, or similar platforms, we want to hear from you! Key Features: 1. User Registration & Authentication: • Borrower...
SEO working for a website ( Jan 2025 )
I need a professional 3D Blender expert who can bake an entire house for me. I have existing 3D models of the house, so there's no need to create new ones from scratch. Key requirements: - 3D baking of the house's entire structure: exterior walls, roof, and interior rooms - Applying low-detail, basic textures to the models Ideal skills and experience: - Proficiency in 3D Blender - Previous experience in 3D modelling and texture baking - Attention to detail while applying basic textures
I'm looking for a creative and innovative designer to craft a promotional brochure for a product aimed at teachers and professors. The brochure should effectively communicate the product's features and benefits in a style that's both engaging and professional. Key Responsibilities: - Design a brochure that is visually appealing and aligns with an innovative and creative style. - Understand and target the content towards teachers and professors. - Use a formal yet approachable tone to convey the product's value. Ideal Skills: - Experience in designing promotional materials, particularly for the education sector. - Strong understanding of visual design principles and creative thinking. - Excell...
...We are seeking a Post-Production Specialist to join our team in finalizing animated film projects. ? Here is the example of the animation that we prefer: . Video length: 5-10minutes. Frequency: 6-7 videos/week. Target: 25 years old and older. You will be responsible for editing visuals, adding special effects, synchronizing audio, and ensuring the final product meets the highest quality standards. Requirements: - Proficiency in post-production software such as Adobe Premiere, After Effects, or equivalents. - Experience in video editing, visual effects, and sound editing. - Creative mindset, attention to detail, and strong teamwork skills. - Time management skills and ability to meet project deadlines. Benefits: - Attractive salary and bonus in a cre...
I'm looking for a professional writer with experience in PR and a strong understanding of the Indian news landscape. The task is to write 5 high-quality articles focused on product information for publication on Indian news websites. These articles will be used for Facebook business verification, so they need to be credible, engaging and reach a wide audience. Key Requirements: - Excellent English writing skills with a knack for creating engaging content - Proven experience in writing PR articles - Strong understanding of product-oriented storytelling - Familiarity with the Indian news landscape - Ability to write for the general public The articles should be informative, highlighting key features and be...
Hello Nick! Thank you for the project invitations. There are some documentation that Raras has been requested. The scopes are: 1. User Journey of my Past Project about End-to-End & Supplier apps. 2. It includes user flow, screen, cta, and description. 3. The details will be how the master data are build, how purchase order and request are submitted, and how the goods are received and updated in to the apps
Description: We are looking for an experienced Python & Selenium Developer to join our team full-time. The ideal candidate will have a strong background in web scraping and web development, with proficiency in various Python libraries and frameworks such as BeautifulSoup, Requests, Scrapy, and Selenium WebDriver. Responsibilities: -- Build and maintain automated web scraping solutions using Python and Selenium. -- Scrape data from websites and efficiently process it. -- Develop and integrate databases with frontend applications. -- Work closely with the frontend team to ensure seamless integration and functionality. -- Collaborate in building and maintaining the business’s web-based systems. -- Work on web development projects using Python and associated tools. -- ...
...the owner of two beauty clinics and I'm seeking a professional designer to create a minimalist and modern design booklet for our proprietary product prescriptions and treatment protocols. This booklet will be used for our clients and needs to cater to both a digital PDF format and a printed physical copy. Key Features of the Booklet: - A comprehensive AM/PM skincare routine detailing step-by-step instructions. - Product usage tips to enhance the skincare experience. - Prescribed treatments with a designated area for describing what each treatment targets. - An elegant and clear overview of our product prescriptions, explaining the purpose and benefits of each product. - Inclusion ...
after the market opening of the day or week or month , indicator will identify the setup candle in a smaller time frame based on my spec and draw horizontal lines on HL that will stay for the rest of the day, week, month.
I'm in need of a music artist or band to re-record 'Kick' by INXS. Key Requirements: - The re-recorded song should fit the same style and genre as the original INXS track. - New lyrics need to be created to avoid copyright issues, but they should maintain the same lyrical theme and subject as the original song. - Additional production elements such as background vocals, instrumental solos, and sound effects are welcomed, but not mandatory. The final decision can be up to your creative expertise. Ideal Skills and Experience: - Prior experience in music production and songwriting. - Ability to replicate the rock style of INXS. - Creativity in composing catchy, relevant new lyrics. - Experience in adding diverse production elements to enhance the track. ...
...Are you a self-motivated sales professional with a passion for helping businesses thrive? Do you excel at identifying prospects, building relationships, and closing deals? If so, we have an exciting opportunity for you! We are looking for a Business Development Manager (BDM) to join our team and help drive the growth of our cutting-edge AI chatbot solutions. This is a commission-only role with unlimited earning potential, perfect for someone with an entrepreneurial spirit and a proven track record in B2B sales. About the Role As a Business Development Manager, you will: • Identify and engage with prospective clients, focusing on small and medium-sized enterprises (SMEs). • Promote and sell our ch...
