Benefits of outsourcing to a virtual assistantJobs
...en desarrollo de proyectos de alta gama a medida (nada de WordPress ni templates). Nuestro proyecto se trata de un marketplace de vehículos automotriz con: compradores vendedores, subastas en tiempo real y arriendo de vehículos. Stack de tecnología a utilizar: Backend- python, JS con framework nest Frontend- React Js DATABASE- postgre o mongoDB Aplicación móvil- React Native (la participación es híbrido) El superadministrador: se usará una plantilla para el Frontend. Las subastas: nuestro área de subastas es en tiempo real, Es decir habrá una persona con el nombre martillero dirigiendo la subasta en tiempo real. Tendrá billetera virtual y la pasarela de pago será con escrow y...
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq":"0","channel":"main-w-chan51-8888-react_uzonm..."broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You can test her...
Hejsa, Søger du deltidsjob som virtuel konto assistant uden at møde op? Carlo tagteknik har leveret tagløsninger i over 10 år - Forespørgslen er stor, derfor har vi brug for en skrap team medlem der kan tag sig af kontor arbejdet. Man behøver ikke møde op :) Det er en fordel hvis du har salg baggrund eller andet it kendskab. No limits bare du er glad og frisk :):):) Lyder det interessant for dig? Så kontakt mig her. Startdatoen: Snarest muligt. *** BEFORE YOU TEXT ME Danish language are required to this job****
Hi I need a reliable assistant/secretary to cut and paste data from websites into new contacts in Hubspot. You will get a list of links to companies like this one Your task is to extract the data and enter them into Hubspot. I am not sure how long it will take, so let's do it on an hourly basis. Please state your fee per hour. Please also write if you have experience with Hubspot. You will need a fast and stable internet connection. I look forward to working with you! Take care Erik
The creation of a virtual office
Hej Mikkel Vi søger dygtug Virtual assisant til vores kunde service, skrive tilbud, tjekke kalender m.m Vil det være noget for dig hvis det er?
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Hej Andreas. Jeg går næsten ud fra at du snakker dansk. :) Jeg har en hjemmeside (), som jeg gerne vil have går i luften. Det er en medlemsskabsside omkring syning, hvor jeg laver mønstre, mini-kurser, tutorials. Det er på en wordpress platform. Jeg har aldrig hyret en hjælper online, men er lidt på udkig efter en virtual assistent, der kan hjælpe mig med lidt forskelligt - så jeg ved heller ikke om du kan hjælpe mig. :) Det jeg tænker på er: - grafik til min hjemmeside - så det ser godt ud. - upload af grafikken, og billeder, videoer, samt opsætning af blog-indlæg. - evt. mail-checkning, hvor de relevante bliver sendt videre til mig. Jeg får en smule mails med spørgsmål om...
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
... PDA based flexible ticket system You are going to implement a prototype of a flexible ticket system. In its complete version it is going to replace the current RF-id tag based system. The new system expected lifetime is 5 year only. In 5 years it is expected that face recognition has advanced sufficiently to allow ticketing based entirely on automatic unattended image processing. While the proposed system only partly reduces the manual control, it will reduce the amount of sign in /sign out equipment on platforms and placing that equipment entirely in the rolling stock. Each train compartment or bus is already equipped with a wireless LAN connected to the InterNet. The train or bus computer knows the current posi...
... PDA based flexible ticket system You are going to implement a prototype of a flexible ticket system. In its complete version it is going to replace the current RF-id tag based system. The new system expected lifetime is 5 year only. In 5 years it is expected that face recognition has advanced sufficiently to allow ticketing based entirely on automatic unattended image processing. While the proposed system only partly reduces the manual control, it will reduce the amount of sign in /sign out equipment on platforms and placing that equipment entirely in the rolling stock. Each train compartment or bus is already equipped with a wireless LAN connected to the InterNet. The train or bus computer knows the current posi...
poster for online posts 3 pictures Bold
...billeder og de sider jeg umiddelbart gerne vil have, men der er nogle tiltag jeg gerne vil have udover det: Virtuelt gallery hvor man ser mine billeder i en stue, køkken, eller i et galleri som det jeg har allerede, under virtuelt gallery. Dette er meget vigtigt for mig. Wordpress da jeg allerede kender til det, dette er et ønske men ikke et must, men jeg skal også selv kunne vedligeholde det. To- eller flersproget mulighed, dansk engelsk tysk spansk og hvis det ikke er muligt, så dansk/engelsk. Gerne en webshop. Responsivt theme Nyhedsbrev-funktion Video funktion Social knapper og aktioner like knap f.eks. Det er vigtigt den loader hurtigt. Det er vigtigt at den bliver fundet af søgemaskiner og rater højt. ...
Contact for details...........................................................................................
Contact for details...........................................................................................
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
Dear Indyainfo i want you to work 8 hours on my site, make it more SEO powerfull. remember link building. I made a list wil a lot of keywords. i just want to be on page 1 at as many as possible if you can do that. Hope to hear from you soon. bedste danske web hosting bedste gratis hosting bedste hosting bedste web hosting bedste webhotel billig domæne hosting billig email hosting billig hosting billig server hosting billig web hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark ho...
Dear Indyainfo i want you to work 8 hours on my site, make it more SEO powerfull. remember link building. I made a list wil a lot of keywords. i just want to be on page 1 at as many as possible if you can do that. Hope to hear from you soon. bedste danske web hosting bedste gratis hosting bedste hosting bedste web hosting bedste webhotel billig domæne hosting billig email hosting billig hosting billig server hosting billig web hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark ho...
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I'm looking for someone with a knack for writing and storytelling. The project is somewhat ambiguous at the moment, but it definitely leans towards creative writing. Ideal Skills: - Excellent command of the English language - Strong storytelling ability - Creative thinking Experience: - Previous work in writing and storytelling - Experience in crafting fiction will be a plus Please note that the type of writing needed may be primarily creative and artistic in nature.
I need a PowerPoint presentation of 2 slides. For the below content * LMS [LEARNING MANAGEMENT SYSTEM] Is a software platform that facilitates the administration, delivery, and tracking of educational courses and training programs. * E-Learning [ATLAS/COURSERA] a platform offering a wide range of online courses and educational resources across various subjects, enabling users to learn at their own pace. * ASK HC [ASK HUMAN CAPITAL] a system that provides an employee ticketing system for enquiries, allowing staff to easily submit questions or issues for prompt resolution and support. * Dashboard [Training demand management progress reporting system] a platform that visualises training results, and analyse...
My IT company is looking for a dedicated professional to manage 3000 business leads per month. We already have the leads. The key tasks include cold calling, email marketing, and social media outreach, with a primary focus on cold calls. The aim is to book complimentary IT assessments, which our team will convert into paying contracts if a need is identified. Key Responsibilities: - Prioritize cold calls to generate business leads. - Engage in email marketing and social media outreach. - Promote the benefits of our free IT assessment during calls. Requirements: - Excellent communication and interpersonal skills. - Experience in cold calling and lead generation, preferably in IT. - Ability to work independently and think on yo...
Descripción del trabajo: Estamos buscando un experto en campaña...virtuales). Nuestro negocio ya está establecido, pero buscamos profesionales adicionales para mejorar nuestra presencia y rendimiento en estas plataformas. Requisitos: Experiencia comprobable en creación y gestión de campañas en: Google Ads Facebook Ads Otras plataformas publicitarias relevantes. Conocimiento del mercado y estrategias publicitarias para nichos de tarot y esoterismo. Trabajo virtual, con disponibilidad para reuniones y seguimiento periódico. Idioma: Castellano (imprescindible). Detalles de la oferta: Pago mensual: $500 USD. Incentivos: Bonificaciones basadas en resultados y rendimiento de las campañas. Solo interesados y con experiencia demostra...
More details: Is this project for business or personal use? Personal What information should successful freelancers include in their application? Detailed project proposals How soon do you need your project completed? Within a month
...improvements and verifications required for the virtual campus system. The main objective is to resolve existing issues and add functionality to ensure an efficient and robust workflow. The script has separate files for administrator, teacher and student, so the changes to be implemented should be replicated based on this structure. 1. Fix CKEditor problem with modal windows Problem: When trying to insert images using CKEditor, the field crashes and cannot continue. Requirements: Identify and resolve the problem that prevents the correct use of CKEditor in modal windows. Ensure that CKEditor functions (e.g., insertion of images, HTML code, and other elements) are working correctly. Test compatibility on multiple browsers and devices. C...
I'm an online seller and I sell handmade organic soaps in the US market but my problem is the payment method. I don't have a private website and I sell items through an online handmade platform. I need a US virtual assistant for this job and I need to help with my ecommerce business. If you don't have any experience, that's okay and I will give you all the instructions on how to work with me.
Valoramos que las personas sepan diseño web y utilizar herramientas de inteligencia artificial como chatgpt y Gemini. 450 USD/mes. Trabajo a largo plazo.
I'm looking for a seasoned Android developer to create a betting app with the following features: - Live Betting: The app should allow users to place bets in real-time on various live sporting events. - Virtual Sports Betting: In addition to real-world sporting events, the app should also provide options for betting on virtual sports. This project also involves implementing user authentication features, specifically: - Social Media Login: The app should allow users to log in using their social media accounts. Ideal candidates for this project should have: - Proven experience in developing Android apps, preferably betting apps. - Strong understanding of implementing live and virtual sports betting functionalities....
...experienced architect or interior designer to design the layout for my two-story building. Each floor is approximately 600 square meters, and the staircase to the upper floor is already located and fixed. The project includes: Upper Floor (Medical Clinics): The upper floor will be dedicated to medical clinics. The goal is to maximize the number of clinics while maintaining usability and comfort. Each clinic should include: • A doctor’s room • A small bathroom • A front desk for the assistant with seating for 2-3 people in the waiting area Requirements: • Efficient space utilization • Comfortable, professional environment • Adherence to building and safety codes Deliverable...
"OpenAI ChatGPT Integration for Website ( Platform)" **Job Description:** We are looking for an experienced developer to integrate OpenAI's ChatGPT API into our website, , hosted on the platform. The goal is to create a custom AI assistant that seamlessly interacts with visitors, providing helpful responses and enhancing user experience. ### **Scope of Work:** 1. **Back-End Development:** - Set up a server to communicate with OpenAI's API (preferred tech: Python Flask, Node.js, or other robust frameworks). - Handle API authentication and request handling. 2. **Front-End Integration:** - Create a user-friendly chat interface that matches the website’s branding. - Ensure it is respo...
I'm looking for a manual data entry freelancer to fetch data from few different websites according to the specified guided steps from me. Key Responsibilities: - Follow the guided steps instruction carefully and perfectly - Make at least 15 full flow steps a week. Ideal Skills: - Strong in learning and understanding in SOP (standard operation procedure) - Excellent reporting skills - Proficiency in AI software tool like chatGPT - Ability to use canvas (or willing to learn it) Experience: - Prior experience in using AI softwares - Experience with YouTube content creation is a plus This is a great opportunity for those with a passion for finance and content creation. The job steps are very easy, it's a routin...
