Automation testing tools open sourceJobs

Filtrér

Mine seneste søgninger
Filtrer ved:
Budget
til
til
til
Slags
Færdigheder
Sprog
    Job-status
    2,000 automation testing tools open source jobs fundet
    Project name
    Udløbet left

    testing project , don't put bid

    €10 - €10
    €10 - €10
    0 bud

    89888765goldenbirds5646546465hgvtftfyddddrddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddd

    €28 - €237
    €28 - €237
    0 bud

    Programiranje za SQL i Android: molim vas vaš kontakt da se čujemo na telefon xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

    €29 - €242
    €29 - €242
    0 bud

    a dialer for my asterisk box kasdjlasjdlasjdlasjdlasjdalsdjalsdjalskjdalskjdalskjdalksjdalskjdalskjdlksajdlasjdalsjdalsjdalsjdalsjalskjd 100chars

    PHP
    min €34 / hr
    min €34 / hr
    0 bud

    hi, i just need somebody for a few hours working for my project, if i like it i have more work. beste regards. Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Aenean commodo ligula eget dolor. Aenean massa. Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus. Donec quam felis, ultricies nec, pellentesque eu, pretium quis, sem. Nulla consequat massa quis enim. Donec pede justo, fringilla vel, aliquet nec, vulputate eget, arcu. In enim justo, rhoncus ut, imperdiet a, venenatis vitae, justo. Nullam dictum felis eu pede mollis pretium. Integer tincidunt. Cras dapibus. Vivamus elementum semper nisi. Aenean vulputate eleifend tellus. Aenean leo ligula, porttitor eu, consequat vitae, eleifend ac, enim. Aliquam lorem ante, dapibus in, viverra quis, feugi...

    €483 Average bid
    €483 Gns Bud
    8 bud

    ...to work with you Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Aenean commodo ligula eget dolor. Aenean massa. Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus. Donec quam felis, ultricies nec, pellentesque eu, pretium quis, sem. Nulla consequat massa quis enim. Donec pede justo, fringilla vel, aliquet nec, vulputate eget, arcu. In enim justo, rhoncus ut, imperdiet a, venenatis vitae, justo. Nullam dictum felis eu pede mollis pretium. Integer tincidunt. Cras dapibus. Vivamus elementum semper nisi. Aenean vulputate eleifend tellus. Aenean leo ligula, porttitor eu, consequat vitae, eleifend ac, enim. Aliquam lorem ante, dapibus in, viverra quis, feugiat a, tellus. Phasellus viverra nulla ut metus varius laoreet. Quisque rutrum. Aenean imperd...

    €29 Average bid
    €29 Gns Bud
    2 bud

    SharePoint 2013 Responsive Design Html 5 For government internet site SharePoint 2013 Responsive Design Html 5 For government internet site

    €27 / hr Average bid
    €27 / hr Gns Bud
    4 bud

    edit a songxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

    €104 Average bid
    €104 Gns Bud
    4 bud

    ddssvdddddfhfhdhjsakhdsakjhdsakhdjsköahdaskjhdsajhdsajkhdaksjhdsöhjdkajshdyaCDFUIVGHEFUBHVEUKRHBIOWUVYGWOIQUFWIVNGUQEHRPIUAFUHBIERUHHAEFEFVJHHJKFEHQFHRB BHIRRULGR

    €17 - €138
    €17 - €138
    0 bud

    !!!!!!!!!!gjhggyug gujgjhguyfujgjhg yguyguyuuyg gjyguyg guyghgiug giuyghjbg ohugo giuygh ouighy oygo gougogo gougogyg gyugoig ogoy gyogog ogyb

    €29 - €242
    €29 - €242
    0 bud

    ...hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting aalborg hvad er et webhotel hvad er webhotel linux hosting open source webshop server hosting danmark start webshop virtual hosting vps hosting danmark web design wordpress theme webbureau webdesign webdesign cms webdesign aalborg webhotel webhotel billigt webhotel danmark webhotel gratis webhotel hosting webhotel priser webshop design webshop løsning webshop system webshop til salg website design using wordpress website design wo...

    €10 / hr Average bid
    €10 / hr Gns Bud
    7 bud
    SEO for TInlap.com
    Udløbet left

    ...hosting billig webhotel billige webhotel billigste webhotel billigt webhotel cloud hosting danmark dedikeret server hosting danmark domain hosting easy webshop email hosting danmark find webhotel free hosting free webhotel free webshop gratis webhotel hjemmeside design aalborg hosting billig hosting i danmark hosting priser danmark hosting aalborg hvad er et webhotel hvad er webhotel linux hosting open source webshop server hosting danmark start webshop virtual hosting vps hosting danmark web design wordpress theme webbureau webdesign webdesign cms webdesign aalborg webhotel webhotel billigt webhotel danmark webhotel gratis webhotel hosting webhotel priser webshop design webshop løsning webshop system webshop til salg website design using wordpress website design wo...

    €8 / hr Average bid
    €8 / hr Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €18 - €147
    €18 - €147
    0 bud

    We want Remote Desktop software (for Mac & Win) like Team Viewer with all its functionality. Please send us ALL THE FEATURES and specification of what you will be providing. Along with the FINAL PRICE Note: 1. Complete and PROPER Source Code with documentation required. 2. No Copyright Script or GPL script. 3. No third-party tools.

    €242 - €726
    €242 - €726
    0 bud

    i want install ngenx mod ..........................................................................................................................................

    €22 / hr Average bid
    €22 / hr Gns Bud
    2 bud

    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

    €29 - €242
    €29 - €242
    0 bud

    fsdfsdddddddderterterrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrdddddddddddddddddddddddddddddddddd

    €32 / hr Average bid
    €32 / hr Gns Bud
    1 bud

    Mit navn er Jonas og jeg er Webudvikler med mere end 7 års erfaring i branchen. * Primært fokus er Webudvikling (HTML/CSS, PHP, MySQL, JavaScript) * WordPress ekspert * Gennemtænkte løsninger, så du undgår unødvendig langtrukne projekter og ekstraarbejde * Kort leverings- og responstid (Haste opgaver er intet problem) * Kompetent rådgivning er vigtigere end øget salg (også selvom man er sælger)

    €29 - €242
    €29 - €242
    0 bud

    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

    €5 - €11 / hr
    €5 - €11 / hr
    0 bud

    NEED programmer ......................................................................00000000000000000000000000000000000000000000000000

    €242 Average bid
    €242 Gns Bud
    1 bud

    jeanpierrejesses09 skype add me thanks xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

    €503 Average bid
    €503 Gns Bud
    2 bud

    I possess a survey dataset centered on tea consumption and I am seeking a skilled data analyst to assist with its evaluation. The ultimate goal is to gain insights that will enhance the data-driven nature of an article I am craftin...of an article I am crafting based on these findings. Key Responsibilities: - Identify correlations between different age groups and their tea consumption habits. - Extract significant insights and trends from the dataset. - Create visual representations (graphs, charts, etc.) to support the article. - Summarize findings in a clear, concise manner. Ideal Skills: - Proficiency in data analysis tools (Excel, Python, R, etc.). - Strong statistical acumen to detect meaningful patterns. - Excellent ability to present findings in a clear and visually appeali...

    €6 Average bid
    €6 Gns Bud
    2 bud

    ...program should utilize custom trading strategies templates and perform essential calculations. Key Features: - Real-time Data Tracking: The program should be able to track stock data in real-time. - Automated Trading: The program should have the capability to calculate parameters and load them for manual execution, then manage trades automatically based on predefined parameters. - Risk Management Tools: The program needs to incorporate features that assess and manage trading risks. Ideal Skills and Experience: - Proficiency in programming with a focus on finance-related software. - Experience in developing trading software is a plus. - Familiarity with stock market and trading strategies. - Skills in creating user-friendly interfaces. Options and Futures contracts to trade. U...

    €427 Average bid
    €427 Gns Bud
    17 bud

    I'm seeking an expert in web scraping and automation with AI capabilities. The primary objective of this project is lead collection from e-commerce websites. Key Responsibilities: - Scrape e-commerce sites for potential leads - Collect specific data - Product details and Customer reviews Ideal Skills: - Proficient in AI-based web scraping tools - Experience with e-commerce sites - Strong data analysis skills

    €114 Average bid
    €114 Gns Bud
    15 bud

    ...Development 4. Target Market Retail Sector: E-commerce businesses, brick-and-mortar stores, supply chain companies. Finance Sector: investment firms, fintech startups, insurance broker firms. 5. Competitive Advantage Industry-specific BI solutions tailored for retail and finance. Expertise in leading BI tools and cloud-based analytics platforms. Strong focus on actionable insights that drive business growth. Scalable solutions adaptable to various business sizes and needs. 6. Technology Stack BI Tools: Power BI, Tableau, Looker Data Processing: SQL, Python, R Cloud Platforms: Google Cloud, AWS, Azure ETL Solutions: Talend, Apache NiFi, Alteryx 7. Marketing and Sales Strategy Networking with professionals in retail and finance. Developing a website with case studies and se...

    €77 Average bid
    €77 Gns Bud
    19 bud

    I'm seeking a dedicated individual with extensive full stack coding experience for an exciting business venture. This opportunity offers a 1% stake in a significantly high-valued business. Key Responsibilities: - Commit three days a week for the ownership model - Collaborate on product development using AI agent platforms like Bubble - Oversee testing, launch, and ongoing maintenance Ideal Candidate: - Exceptional full stack coder with proven capabilities - Has strong communication skills and proficient in English - Able to meet deadlines and collaborate effectively - Interested in a long-term partnership with significant potential returns Skills and Experience Required: - Proficient in JavaScript et al (see details below) - Extensive experience with AI development platf...

    €96791 Average bid
    NDA
    €96791 Gns Bud
    12 bud

    I'm seeking a highly proficient part-time Artificial Intelligence instructor to teach advanced level students in various aspects of AI, with a focus on Machin...a focus on Machine Learning, Deep Learning, and Natural Language Processing. The classes will be conducted exclusively online, requiring a strong command of digital teaching tools. Key Requirements: - Expertise in teaching at an advanced level - In-depth knowledge of AI, specifically Machine Learning, Deep Learning, and Natural Language Processing - Experience with online teaching platforms - Ability to conduct engaging, interactive 1-hour sessions Ideal Skills: - Advanced degree in AI or a related field - Proven track record of teaching AI topics - Excellent communication skills - Proficiency in digital teaching t...

    €8 / hr Average bid
    €8 / hr Gns Bud
    3 bud

    I’m looking to acquire an already developed online business or software that generates income. I need something functional and tested, where the creator can show me how it works an...demo or proof of the system in action. ✔️ Information about maintenance costs and potential improvements. ? Examples of What Interests Me: Mobile applications with monetization (subscriptions, ads, in-app purchases). Affiliate or dropshipping automation systems. Trading bots or investment automation software. SaaS (Software as a Service) platform with active subscribers. Any other scalable and profitable online business idea. If you have something already running and generating revenue, please send me details, examples, and proof of income. I’m open to discussing options and ...

    €406 Average bid
    €406 Gns Bud
    31 bud

    I need a dedicated professional to help me with data formatting and managing my data workflows. As I'm an expert in but too busy, your role will be crucial in pulling lists, formatting data and ensuring...Responsibilities: - Data formatting: Adjusting data to fit into our established workflows - Administering Data Workflows: Overseeing the functioning of our data systems Ideally, you will have: - Experience with - Strong data formatting skills - Previous experience in managing data workflows - A background in dealing with contact details You will be trained on how to use the systems and tools, and we will compensate you even when there is no work. Initially, we will offer 10 hours a week, with the potential for more. The data will need to be formatted and updated weekly.

    €13 / hr Average bid
    €13 / hr Gns Bud
    41 bud

    ...and related topics. Key Responsibilities: - Develop an AI tutor proficient in Python, JavaScript, Java etc. - Design the AI tutor to pose questions related to algorithms and data structures, system design, and language-specific features. - Ensure the interview questions are of intermediate difficulty. The application should: - Interact with users via voice to voice. - Leverage backend tools like Google Text to Speech API, chatGPT, or similar technologies. - Utilize a real 3D character with proper lip-sync to create a realistic tutoring experience. Ideal candidates will have: - Extensive experience in AI development. - Proficiency in the specified programming languages. - A deep understanding of the interview topics and the ability to create engaging, relevant q...

    €5305 Average bid
    €5305 Gns Bud
    8 bud

    I'm an e-commerce seller seeking a proficient Excel specialist who can create formulas and automate processes for my inventory tracking. Key Responsibilities: - Develop Excel formulas and automate processes to enhance efficiency - Create inventory level alerts to prevent stock sh...seller seeking a proficient Excel specialist who can create formulas and automate processes for my inventory tracking. Key Responsibilities: - Develop Excel formulas and automate processes to enhance efficiency - Create inventory level alerts to prevent stock shortages - Conduct sales tracking and analysis to inform business decisions Skills & Experience: - Advanced Excel skills with a focus on automation - Previous experience in e-commerce inventory management - Proficient in sales tracking...

    €15 Average bid
    €15 Gns Bud
    20 bud

    I'm seeking a proficient web developer to create a comprehensive blog website tailored for entrepreneurs and founders. This platform should encompass a variety of content types, from how- to guides, case studies, reviews, to tools and resources. Key Features: - An array of content categories, including but not limited to: ideas, guides, reviews, case studies, resources, tools , start , grow and monetize. - A system for invite-only contributors, to maintain exclusivity and quality of content. - A robust paywall feature, to monetize the site effectively. - An integrated newsletter subscription system, to keep our audience engaged and updated. All content types, from how-to guides to case studies and reviews, are deemed equally important for this blog. Therefore, the ideal...

    €199 Average bid
    €199 Gns Bud
    10 bud

    ...timely and well-documented cost breakdowns for bids, proposals, and budget planning. Qualifications & Skills • Experience in material takeoffs and cost estimation in [industry, e.g., construction, manufacturing, engineering]. • Strong understanding of engineering drawings, blueprints, and CAD models. • Proficiency in estimation software (such as Bluebeam, PlanSwift, Excel, or industry-specific tools). • Ability to work with engineers, architects, and project managers to refine estimates. • Strong analytical skills with attention to detail. • Excellent communication and negotiation skills for working with vendors and suppliers. • Ability to manage multiple projects and meet tight deadlines. Preferred Qualifications • Degree in ...

    €24 / hr Average bid
    €24 / hr Gns Bud
    30 bud

    ...Convert AI responses back to speech with OpenAI's TTS API Automation & CRM Integration Log AI-generated call summaries into GHL’s CRM Notes Trigger follow-up actions (e.g., SMS, emails, appointment scheduling) Deployment & Optimization Host the solution on a cloud platform (AWS, Heroku, or similar) Optimize AI responses for natural and engaging conversations Provide basic documentation for future maintenance Ideal Candidate: ✅ Proficient in Python (Flask, FastAPI) or Node.js ✅ Experience with Twilio Voice API & Webhooks ✅ Strong understanding of OpenAI’s GPT, Whisper, and TTS APIs ✅ Familiarity with GoHighLevel CRM and API integration ✅ Experience deploying applications on AWS, Heroku, or similar platforms Budget & Timeline: ? Budget: Open...

    €450 Average bid
    €450 Gns Bud
    42 bud

    ...agency specializing in AI, process automation, and blockchain solutions for businesses ranging from small startups to large enterprises. We need a dynamic, responsive, and visually engaging website that clearly communicates our services, showcases our expertise, and inspires both potential clients and talented professionals to join our mission. Key Requirements Clean, Modern Design A professional, user-friendly layout that captures our innovative brand. Consistent color schemes, typography, and visuals aligned with an AI/technology theme. Core Pages & Structure Home Page: Bold hero section, clear value proposition, calls to action. About Us: Company story, mission/vision, team bios, and unique selling points. Services: Detailed breakdown of AI, automation, and block...

    min €48 / hr
    Fremhævet Forseglet NDA
    min €48 / hr
    11 bud

    I'm looking for an Arduino-based device to test my NiMH Prius hybrid battery. The batteries range from 200V to 220V (7.2-7.5V per cell and it has 28 cells) and I specifically need the tester to measure the capacity (mAh) of the whole battery. Imagine, you can easily chec...easily check battery health when the battery is in the car, you can plug OBD2 device and measure the battery's SOH using the Dr. Prius app. I need a device to inspect the hybrid battery when it's not in the car. I need that device to be built and shipped to me with basic instructions on how to use it. Skills and experience needed: - Proficiency in Arduino programming - Experience with battery testing equipment - Understanding of NiMH battery specifications - Capability to design a device that can...

    €1460 Average bid
    €1460 Gns Bud
    18 bud

    I'm seeking a proficient web developer to create a comprehensive blog website tailored for entrepreneurs and founders. This platform should encompass a variety of content types, from how- to guides, case studies, reviews, to tools and resources. Key Features: - An array of content categories, including but not limited to: ideas, guides, reviews, case studies, resources, tools , start , grow and monetize. - A system for invite-only contributors, to maintain exclusivity and quality of content. - A robust paywall feature, to monetize the site effectively. - An integrated newsletter subscription system, to keep our audience engaged and updated. All content types, from how-to guides to case studies and reviews, are deemed equally important for this blog. Therefore, the ideal...

    €126 Average bid
    €126 Gns Bud
    7 bud

    ...automating lead generation, with an efficient nurture email sequence integrated into the email follow-up process. The funnel should also include a comprehensive automation system for text follow-ups. I would like potential prospects to have an A.I. interactive experience throughout the process. Please note, the ideal candidate should have: - Proven experience with HighLevel - Exceptional skills in sales funnel construction - Proficiency in AI tools for prospect interaction - Expertise in designing and automating nurture email sequences - Capability to set up and automate text follow-up campaigns - Strong understanding of lead generation automation The ultimate goal is to have a fully automated, efficient sales funnel that can help me generate leads and nurture th...

    €433 Average bid
    €433 Gns Bud
    19 bud

    ...map Technical Stack (Non-Negotiable) Frontend: Flutter with Bloc Backend: Supabase Front end: Hive or similar Additional: NodeJS (if required) Required Deliverables (5/6-Week Timeline) Week 1 Technical architecture documentation Database schema implementation Basic auth and profile features Week 1-5 Chat system implementation Location services integration Community forum development Week 5-6 Testing and bug fixes App store deployment packages Documentation completion Mandatory Technical Skills Proven Flutter/Dart expertise (proven experience in App building) Bloc state management Supabase implementation Real-time communication systems Geolocation services integration (User location x KM away) iOS/Android deployment experience Application Requirements Portfolio featuring simi...

    €2206 Average bid
    €2206 Gns Bud
    31 bud

    Amblyopia Treatment Tracking App – Mobile Developer Needed Project Type: Mobile App Development (iOS & Android) Budget: Open to quotes – Looking for quality & expertise Deadline: 3-6 months Project Overview: I’m a pediatric ophthalmologist developing an app to assist parents and children with amblyopia (lazy eye) treatment. The app will track patching compliance, treatment progress, and medication use, while allowing treating ophthalmologists or orthoptists to input treatment plans. Key Features: ✅ Patching Tracker: Timer to track how long the child wears an eye patch daily. ✅ Doctor Dashboard: Secure login for ophthalmologists/orthoptists to input treatment details (e.g., “Patch right eye 2 hours daily”). ✅ Pharmacological Treatment Tracke...

    €30 / hr Average bid
    €30 / hr Gns Bud
    44 bud
    XIAO ESP32C3 Code Development
    6 dage left
    Godkendt

    ...input a "key" for thingsboard.io. The primary purpose of this code is to gather and transmit sensor data. The telemetry transfer method will be simple HTTP POST requests that include the following values: - Battery voltage from pin A1 (using a 220k voltage divider from a 3.7v battery). - Temperature from pin D8 (using a DS18B20 one-wire temperature sensor). - Input1 from pin D4 (open/closed). - Input2 from pin D6 (open/closed). At this time, no Remote Procedure Call (RPC) is required. The ideal candidate for this project has experience with: - Setting up a WiFi access point. - Acquiring data from sensors. - Implementing HTTP POST requests. -arduino -esp32 A web interface is required for the WiFi access point setup. The ability to create an intuitive and us...

    €99 Average bid
    €99 Gns Bud
    8 bud

    ...Create a versatile logo for use on a website () and across social media platforms. - Design a 3-dimensional, backlit sign for the physical storefront. Ideal Freelancer: - You should be able to think outside the box and avoid conventional grooming symbols like scissors, razors, mustaches, and combs. - A knack for modern, classic, or vintage design styles will be beneficial, as I am open to all. - I have a preference for unique designs, so a portfolio showcasing creative and distinctive logos will be highly regarded. - Experience with 3D sign design is a plus. Skills Needed: - Graphic Design - Logo Design - 3D Modeling - Signage Design - Brand Identity Development...

    €302 Average bid
    €302 Gns Bud
    63 bud

    We are looking for someone to perform an in-person audit at a testing center in Tokyo, Japan. This audit is being conducted to assess if the staff on site is following the rules and regulations and are monitoring test takers to ensure there is no cheating going on. This is a great opportunity to help improve standardized test administration. We provide full training and this assignment. ***PLEASE NOTE: Once you are booked the audit cannot be postponed or assigned to a different freelancer.***

    €17 - €24 / hr
    Lokal
    €17 - €24 / hr
    0 bud

    I'm seeking a developer experienced in OAuth2 and Buddyboss to create a tailored Single Sign On (SSO) solution for a network of Buddyboss sites. Solution needs to be built using open source software and scalable without restrictions on number of users. This is a proof of concept and implementation validation - a more robust solution will be implemented once we validate the ability to connect users to multiple websites, using a single registration and login. We'll start with a small network of 10 websites Key Requirements: - The SSO should support the OAuth2 authentication method.- Open Source code only - It must facilitate logins from Google as an external identity provider. - The solution should sync users' profile details and activity hist...

    €1188 Average bid
    €1188 Gns Bud
    19 bud

    We are looking for someone to perform an in-person audit at a testing center in Algiers, Alger, Algeria This audit is being conducted to assess if the staff on site is following the rules and regulations and are monitoring test takers to ensure there is no cheating going on. This is a great opportunity to help improve standardized test administration. We provide full training and this assignment. ***PLEASE NOTE: Once you are booked the audit cannot be postponed or assigned to someone else.***

    €17 - €24 / hr
    Lokal
    €17 - €24 / hr
    0 bud

    I need to create animated videos to post on TikTok. I have script and voices ready and need someone to create animation in a unique and consistent style. - Animation Style: The desired style is 2D or vector-based animation. The animation should be clean, smooth, and visually ap...characters in this project shall all have faces like the ones in the attached images, but with different facial expressions that match the skit. Ideal Skills: - Proficiency in 2D vector-based animation - Experience with creating content for TikTok - Ability to convey humor and fun through animation - Strong understanding of timing and pacing in animation Ideal candidate know how to use automation and/or AI tools to be able to produce large quantity of content at scale. We plan to put out about 1-...

    €366 Average bid
    €366 Gns Bud
    40 bud

    Buckle up and hit the streets in Bhaag Gadi Bhaag, a high-octane driving game where speed, skill, and chaos define your journey! Inspired by the thrill of high-speed pursuits and adrenaline-packed stunts, this game brings realistic driving physics and intense chases to life. ? Key Features: ? Realistic Car Physics – Experience smooth and responsive vehicle handling. ?️ Open-World Streets – Navigate through bustling city roads, highways, and off-road shortcuts. ? Police Chases & Street Races – Dodge cops or challenge rivals in intense races. ?️ Customization – Upgrade and modify your rides for max performance. ? Dynamic Soundtrack – Feel the rush with high-energy beats (powered by Mureka AI). ? Action-Packed Missions – Escape roadblocks, drift...

    €2756 Average bid
    €2756 Gns Bud
    1 bud

    I'm looking fo...Responsibilities: - Develop AI-powered chatbots for customer support, lead generation, and sales automation. - Integrate these chatbots with WhatsApp, our website, and various social media platforms. - Automate workflows using AI and APIs to enhance operational efficiency. - Set up integrations with a restaurant-specific CRM to effectively capture and manage leads. - Create AI-driven responses to improve customer interaction. Ideal Candidate: - Extensive experience in chatbot development, API integrations, and AI automation tools. - Familiarity with restaurant-specific CRMs. - Excellent problem-solving skills to streamline and optimize our processes. If you possess the necessary skills and have a passion for automation, let's discuss...

    €129 Average bid
    €129 Gns Bud
    12 bud

    ...educators and students globally and need a skilled **LMS Expert** to enhance our Learning Management System. **Role Overview**: As our LMS Expert, you’ll design, develop, and optimize our platform to support live classes, recorded courses, and interactive tools. Your work will bridge cutting-edge technology with seamless user experiences for teachers, students, and parents. **Key Responsibilities**: - Customize and scale our LMS (e.g., Moodle, Open edX) for global accessibility and low-bandwidth regions. - Integrate live-class tools (Zoom, BigBlueButton), payment gateways, and AI-driven features (analytics, chatbots). - Ensure cross-device compatibility (mobile, desktop) and troubleshoot technical challenges. - Collaborate with educators to ali...

    €259 Average bid
    €259 Gns Bud
    38 bud

    ...problem is isolated to my personal profile, as my business page and phone are functioning correctly. - I can comment on videos, but not on photos. - This issue is impacting all photos on my personal Facebook posts. I need this issue resolved urgently, as it is affecting my business. I have already attempted various troubleshooting measures, including clearing caches, running full system cleanups, testing on different browsers, and trying from another computer. Unfortunately, none of these have been successful. Ideal skills for this job include: - Expertise in troubleshooting Facebook issues - Strong understanding of privacy settings and software compatibility - Excellent communication skills for providing updates Please contact me directly with how you can assist. Time is of t...

    €22 Average bid
    €22 Gns Bud
    5 bud