Allegany college of marylandJobs
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq"...com","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You ca...
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I'm looking for assistance with a project involving 1000 PDF files. This task will require the integration of new pages into each document, which should be placed at the end of the PDFs. The new pages will consist of a mix of content. Some will be provided by me, whilst others will need to be created by the freelancer. The new pages will incorporate both text and images. Therefore, the ideal candidate for this project should have: - Proficiency in PDF editing software - Ability to create and edit content (text and images) - Attention to detail to ensure the new pages are accurately added to each PDF Please note that this project will require careful handling of a large volume of files, and the successful candidate will need to demonstrate t...
Project Description: I am seeking an experienced cybersecurity expert to provide an independent technical assessment regarding the use of a travel router during remote work. The assessment will focus on the router’s capabilities and its alignment with secure remote working practices. Scope of Work: Review the technical specifications of the router and confirm whether it is capable of circumventing corporate network security. Assess whether the router’s use aligns with industry-standard secure remote working practices. Evaluate whether the router posed any cybersecurity risks to the corporate network. Provide a formal, detailed report summarizing the findings in non-technical language suitable for presentation to a non-technical audience. Provided Ma...
I have a few black and white photos that I'd like to have colorized and restored. Some of these photos have tears or cracks, while others are faded or discolored. This project is deeply personal for me, as the restored photos will be used as keepsakes. Ideal Skills: - Photo editing software expertise (Photoshop, Lightroom, etc.) - Experience in photo restoration and colorization - Attention to detail to ensure high-quality restoration You should be able to deliver a product that is not just a repair of the original photo but a beautiful, vibrant image that can be treasured for years to come.
Two bottles designed with embossed logos and a website link. Embossed logo on the front, link on the bottom of the bottles. Readjustment of the thread to meet the SP standard on the bottle To deliver: Two native files (Autodesk Inventor 2025). Two neutral files STP.
I'm looking for a s...skilled developer to create a minimal Microsoft Teams bot. This bot will handle incoming PSTN or Teams calls by directing them to the first user. If the call isn't answered, it must redirect to a second user using the MS Graph API method Redirect. Requirements: - The bot must be developed preferably in Kotlin, though other languages like Golang, C# and others are also acceptable. This is a POC, proof of concept to explore the Graph API capabilities. - The bot must obligatory use the API method Redirect to redirect the call to the second user. - The bot will be deployed on Azure. - The bot must log call details. Ideal Skills: - Proficient in bot development for Microsoft Teams. - Familiar with MS Graph API and Azure. - Experience in logging and track...
I'm seeking a skilled developer to convert my existing Ionic application into an iOS version, alongside a complete UI redesign. - The iOS version should retain all functionalities as the current Ionic application. - The UI redesign is a critical part of this project. While I haven't specified a particular style, I'm open to suggestions and would appreciate a modern, user-friendly design. - The app should remain functionally identical to the existing version, so a thorough understanding of both iOS development and the Ionic framework is crucial. Ideal Skills and Experience: - Extensive experience in iOS app development - Proficiency with the Ionic framework - Strong UI/UX design skills - Ability to deliver a high-quality, bug-free application on time - Excelle...
I'm in need of a professional with extensive experience in managing Jetson AGX Orin systems. The project involves: - Remote service for flashing the Jetson AGX Orin. - Configuring the 40 pin header for digital inputs/outputs and PWM signals. The 40 pin header will be connected to encoders and cameras. Therefore, a solid understanding of interfacing such peripherals is essential. Your expertise in this domain will ensure the success of this project.
...-------------------------------------------------------------------- I need to re-run a published paper work, and precisely, the BKL model using different alpha/gamma parameters as shown in Table#3 in the experiment section (see attached table and paper). The project involves: - Understanding published paper code in github: . Basically, - It's a hybrid of two models: Splade (MLM Bert based retrieval model) and Colbert (HuggingFace ranking model) - already done. - Running the code on a slurm/linux cluster Ideal candidates should have: - Experience in understanding complex LLM code - must - Prior work with the Splade and Colbert models - or any LLM model - Familiarity with slurm clusters - optional I will provide access to the cluster
I'm seeking a seasoned WordPress professional to complete my partially built educational services platform, studymavin. The site is intended to serve as a comprehensive educational resource, and requires the following functionalities: - Pages ...intended to serve as a comprehensive educational resource, and requires the following functionalities: - Pages listing colleges and courses: This is the most crucial aspect that needs your expertise. The pages should be well-structured, user-friendly and truly reflective of the Figma designs. - College page should have sections like overview, courses, reviews - Review functionality for colleges: Users should be able to post and read reviews. - Login/Signup functionality - Search option. - I'll share the detailed documentat...
I'm looking for a professional graphic designer to create a vectorial PDF design of my logo and accompanying text. The final product needs to be print-ready. Key requirements: - Color gradient: An important aspect of this project is accurately applying the specified orange color gradient. - Handwritten Style: The logo's handwritten aesthetic needs to be meticulously replicated. - File Organization: Both the logo and text should be in separate files, alongside a combined file that mirrors the example picture. The example picture is in PNG format. Additional requirements: - Font: You will need to use the font from the example picture for the text. - File Format: The final deliverables should be in AI (Adobe Illustrator) format. Ideal candidates for this project sh...
...online sessions aimed at college students. The course should cover: - Programming languages: Insights into key programming languages, their applications, and practical coding exercises. - Network Security: Fundamental concepts of network security, threat identification, and defense strategies. - Database Management: Core principles of database management, practical exercises, and real-world applications. Ideal candidates should have: - Extensive knowledge in IT and its subfields - Previous experience in teaching college students - Proficiency in delivering engaging live online sessions - Expertise in programming languages, network security, and database management - Ability to create and implement practical exercises I am looking for a professional who i...
Project goal To design unique and vibrant logos for college fan engagement that represent different schools using specified text styles and specific colors. Brand Guidelines Logo designs will reflect the respective school's colors, capturing the spirit and enthusiasm of college sports. Style will range from playful script to traditional collegiate block letters. Scope of work - Creation of logos using the format 'Uniquely[SchoolName]' for different colleges - Designs in two styles: one in script and another in collegiate block letters - Adapt logos to be suitable for various social media platforms -Rate woudl be for 5 schools. Read more Additional information - The buyer requests samples and rates from freelancers interested in working ...
I need a small, professionally styled motion graphics animated video of my company logo. This animation will primarily be used for presentations, so it needs to be polished and visually appealing to match the tone of a corporate setting. Ideal skills and experience for this job include: - Proficiency in motion graphics software - Experience in creating professional, corporate-style animations - Ability to deliver high-quality work suitable for presentations The final animation should seamlessly integrate with a variety of presentation formats and maintain a high level of visual quality.
I'm looking for a modern digital artwork of Jesus as described in the Book of Revelations. The piece should depict Him with ''white hair as wool and eyes that look like flames of fire''. PLEASE USE THE PAINTING BY JOHN CAMPBELL...I would like to use the exact face but change the hair white wool and the eyes that look like flames of fire. **********Please look at the skin complection of image I posted by John Campbell. I prefer a brown skinned complection.***** the full Body picture is an great example of serene and peaceful. Emotional Tone: - The overall emotional tone of the artwork should be 'serene and peaceful'. Ideal Skills: - Modern digital art - Attention to detail - Ability to convey emotions...
...(OCs) as they enter a fantastical, enchanted forest. Key features of the project: - Style: The animation should be cartoonish, capturing a lighthearted and whimsical mood. - Setting: The fantasy realm is primarily an enchanted forest, so there should be plenty of vibrant, magical elements typical of such a setting. - Mood: The GIF should convey an exciting and adventurous journey, filled with playful twists and turns. - Specific Element: A 'Welcome to Astoria' banner or writing in the sky. This should be integrated into the scene in a creative way. Ideal Skills and Experience: - Proficiency in creating high-quality, engaging cartoonish animations. - Experience with creating GIFs suitable for this style. - Strong understanding of pacing, timing an...
I'm seeking an experienced designer to enhance my PowerPoint presentation. The main focus will be on improving the graphics and visuals. I have completed the pack and need it made more professional with some visuals and improved layout. Key Requirements: - Transform the presentation into a more corporate and formal style. - Utilize a preferred color scheme I will provide. - Suggestions for optimal design layout and visual elements. Ideal Skills: - Proficiency in PowerPoint and graphic design. - Expertise in creating corporate and formal presentations. - Ability to work with provided color schemes and design elements.
I need my training material translated and culturally localized from English to multiple Indian regional languages. The material is currently in PDF format and needs to be translated into Tamil, Bengali, Telegu, Kannada, Malayalam, and Hindi. Ideal skills and experience: - Proficiency in English and the target languages - Experience in translation and localization...culturally localized from English to multiple Indian regional languages. The material is currently in PDF format and needs to be translated into Tamil, Bengali, Telegu, Kannada, Malayalam, and Hindi. Ideal skills and experience: - Proficiency in English and the target languages - Experience in translation and localization - Familiarity with training material - PDF editing skills - Cultural understanding of the target...
Hi Motiur, I'd like to scrape a number of entries off of a webpage list of 232 different law firms. Most I'd like are shown on the primary page. If possible, I would also like to pull the description of the firm on the profile page linked to the primary page (I've called this the "clickthrough description" in the excel template). Do you think you can get all this information for the firms? Best, Will
I'm looking for a talented artist to create a stunning, realistic watercolor portrait that portrays the love and pain of the world. - Style: The portrait should be in a realism style. - Medium: The artist should be skilled in using watercolor. - Subject: The central subject of the portrait will be multiple people, so the artist should be experienced in portraying human figures. The final piece should be able to attract a multitude of souls. Ideal candidates for this project should have a deep understanding of human emotions and experiences, and be able to translate that into their artwork.
I am seeking a skilled professional to create After Effects videos for me. The content is adult explicit in nature and will be primarily aime...for me. The content is adult explicit in nature and will be primarily aimed at the adult entertainment niche. Work involves: - Using my private stock of AI generated images and photos to create realistic and natural styled videos - Creating a storyline for each video as I do not have a specific narrative The videos will be 1.30 minutes in length, and payment will be per video. Ideal candidates will have a portfolio of similar content, a strong understanding of After Effects, and the ability to create engaging and entertaining storylines. Please note that the content is explicit and will require a level of comfort a...
I need a legal professional to represent me in court regarding a breach of contract case against an individual. The primary issue at hand is non-performance and refusal on their part. Ideal Skills and Experience: - Extensive experience in contract law - Proven track record in court representation - Strong negotiation skills - Excellent communication skills - Ability to prepare and present legal documents
I'm looking for a web application for a job portal, developed in Python's Django framework with a MySQL database. This will be for my college project, so it needs to be functional, clear, and well-structured. The portal should cater to job domains including tech, gigs, and freelancers, with job categories such as part-time, full-time, and on-field. Key Requirements: - Support for three user roles: Job Seekers, Employers, and Administrators. - Integration of social media login with Google specifically. - Use of Django and MySQL for a robust backend. Ideal Skills and Experience: - Proven experience in Python and Django framework. - Proficiency in MySQL database management. - Prior projects involving job portals would be an advantage. - Experience integrating ...
I have an ebook, a paperback and an audio book. I have a basic course and advanced course that I want to sell in one funnel. My site is on Wordpress and I need a cart. I'd like the ebook and paperback to be sold via Barnes & Noble and/or Amazon, same with Audio book (audible). The two courses I want to collect fees via Stripe or other. I need a cart to manage this. If it has an affiliate system for others to promote that's a bonus but not required. I need suggests and help getting this set up. Who's done this before and can bang this out quickly? Thanks in advance, Sean