Written english typing speedJobs

Filtrér

Mine seneste søgninger
Filtrer ved:
Budget
til
til
til
Slags
Færdigheder
Sprog
    Job-status
    2,000 written english typing speed jobs fundet
    English to French
    Udløbet left

    As discussed - https://www.freelancer.co.uk/users/l.php?url=https:%2F%%2Fspreadsheets%2Fd%2F1nvo-U4DoeBK9NABdqOfCxJbNtx_bi4WnXtMHP927g6c%2Fedit%23gid%3D1761056546&sig=ae833c357c401da5803eac26c4379dece68c67abae9ec432c793a35434f144d6 https://www.freelancer.co.uk/users/l.php?url=https:%2F%%2Fspreadsheets%2Fd%2F1Vx_gMQdOemUmfRwBzPqE7BboZ1cMAmMt_s3VpWeL9Lg%2Fedit%23gid%3D196274952&sig=9e09b8297dc882dbcd45060b5c05b3510f7d2bf0cac9cf1d98884e9d7cf791b9

    €90 Average bid
    €90 Gns Bud
    1 bud

    I must have made a chat robot that can answer chats in a chat program automatically, it must be able to keep a conversation running via chat gpt or similar AI, it must be able to speak both Danish, English and Norwegian. It must be able to answer the texts itself in the window where the text is to be written I has to be able to read previous chats and answers on the website

    €162 Average bid
    €162 Gns Bud
    3 bud

    Er du villig til at flytte og arbejde i et andet land? Vi venter på dig i Estland. Niveau: Indgangsniveau/nyuddannede/Middelniveau. Branche: Rejser Jobkategori: Kundesupport/Kunderådgivning/Kundeoplevelse Varighed: langsigtet (mindst 1 år) Beliggenhed: Estland (betalt flytning), på stedet/hybrid Sprogkundskaber: Dansk (flydende) og engelsk (mindst B1) Vi søger en flydende dansk sprogbruger (mundtligt og skriftligt) til at hjælpe med vores kundesupportopgaver hos kunder (dette er jobbet på stedet og kræver flytning). Engelskkundskaber (mindst B1) kræves, da uddannelsen, før du starter et job, er på engelsk. -Du bør være indehaver af pas i EU eller Schengen-zonen på grund af krav om flytning....

    €14 / hr Average bid
    €14 / hr Gns Bud
    7 bud

    The specs for this project are Wordpress based / Editable in the backend of the site Fast in google page speed insights Goal is under 2 seconds on all pages WP rocket + CACHING + MINIMISE PICTURES Features Videos Picture slides Animation videos Editable text Editable pictures Editable blocks Editable logos Create unique URLS - SEO wise Design wishes 14 different logos containing the name of each “BRAND name” FIGMA only / UX optimizing just like on FIGMA project Requirements WORDPRESS BASED Able to connect up with our DIV - contact formular on - FROM OUR BACKEND DEVELOPER (RoR Ruby On Rails) It should always be possible to load external JS as the current one is based on, so I don't think they can make something that won't work with the type of solution we...

    €4326 Average bid
    €4326 Gns Bud
    52 bud

    I like you to teach me online how to solve two issues with my homepage made in Yootheme. I imagene, that I/you share screen and you talk me though. I guess It will take around 1 hour. This is the homepage: This is the tasks that I need to have solved: 1) I like to have a Trustpilot logo on top of the video. Just like they do here: I have the trustpilologo in png format I have tried one suggested solution online, but then my Header also get transparent, I do not wish that. 2) I like to learn how to make one element, that I can copy to different location - but I only need to make changes one place. The element should have one "mother" so to speak. The four boxes on the front page with Begravelse, bistættelse, gør mere selv afsked og sig farvel på din m&arin...

    €31 Average bid
    €31 Gns Bud
    8 bud

    Page speed for my website is so bad: I need this fixed. Plugins and website have to run the same way (unless we agree on disable).

    €127 Average bid
    €127 Gns Bud
    101 bud
    €10 Gns Bud
    1 bud

    typing,designing

    €14 / hr Average bid
    €14 / hr Gns Bud
    1 bud
    Microsoft Typing
    Udløbet left

    Typer of Files in Microsoft Office

    €6 / hr Average bid
    €6 / hr Gns Bud
    129 bud

    I have written a 4 page paper that I need help with editing. I am a creative author :)

    €18 / hr Average bid
    €18 / hr Gns Bud
    25 bud

    Hi, We need general text about flights. Written in simple, understandable sentences. Length: 3000 signs with spaces or 450 words Theme: 4 paragraphs about 1. Travel by plane - it’s safe, fast, cheap and comfort 2. When is the best moment for ticket reservation - 3 month before short travel, 5-6 month before intercontinental flights 3. Differences between low cost carriers and regular airlines - price (lower / higher), luggage politic (free hand luggage, paid registered luggage / free luggage), routes (continental / continental and intercontinental) and others. 4. What can I take to plane (to hand luggage)? (eating, drinks and others) What we want: • We like keywords: cheap flights, cheap tickets. It would be great if you will use them two or three times. It&rsq...

    €335 Average bid
    €335 Gns Bud
    10 bud

    I need a web page like this one: i want same functions, the same pages. same words. want to be able to change the ad boxes.

    €42 Average bid
    €42 Gns Bud
    7 bud

    Database description Database to be run on Internet, with a small number of users, now 6 users. Login for each user, the database is not visible if you are not logged in. The database to be used for the creation and search of records. The information consists of standard personal data, address, and mail. Typing the postcode, the city name is found in an underlying base. Furthermore, there is the creation date / correction date 3 text fields and 2 dropdown field - and a note field. One drop down box shows the default login person (which is part of the drop down option) Searching is done on 3-4 fields individually, and results are displayed as list, which can be clicked on, as each result is displayed. The layout may be edit via CSS. The database must be a SQL database. Th...

    €265 Average bid
    Fremhævet Haster
    €265 Gns Bud
    9 bud
    Design et Logo
    Udløbet left

    Logo til bog forlag. Navnet på forlaget er FODNOTE (FOOTNOTE in English). Vi har tænkt os logoet eventuelt udformet som et fodaftryk (shaped as a footprint) med forlagets navn skrevet inde i selve fodaftrykket (the Companys name written in the footprint). Vi er dog meget åbne for vidt forskellige logoer, der også er meget anderledes end vores forslag. Efter valg af logo har vi sandsynligvis brug for at få lavet en samlet grafisk løsning.

    €242 Average bid
    €242 Gns Bud
    23 bud

    Jeg ønsker at få skrevet en håndbog til pelsdyravlere, medarbejdere, dyrlægere og rådgivere som har fokus på driftsoptimering af pelsdyrfarmene via forbedring af dyrevelfærden. se mere på , , , I want to have written a handbook for fur farmers, employees, veterinarian and consultants who focus on operational optimization of fur farms through the improvement of animal welfare.

    €1431 Average bid
    €1431 Gns Bud
    4 bud

    Oversætte kærestebreve fra engelsk/dansk til kinesisk. Beskrivelsen er både på engelsk og dansk! Der er 5700 ord. Det skal helst være en være en oversætter, som har erfaring med oversættelse af romantisk og poetisk indhold! In English! Translating love letters from English / Danish to Chinese. The description is in both English and Danish! There are 5700 words. It should preferably be a be a translator who has experience with translation of romantic and poetic content!

    €297 Average bid
    €297 Gns Bud
    4 bud

    Typing jobs, Form filling etc.

    €136 Average bid
    €136 Gns Bud
    18 bud
    SEO min Hjemmeside
    Udløbet left

    Jeg skal have lavet min side, så den er så tæt på 100 som muligt her Samtidig skal jeg have lavet SEO på min side - Du SKAL have referencer når du byder på denne opgave.

    €244 Average bid
    €244 Gns Bud
    9 bud
    DTP Job
    Udløbet left

    I Am DTP Operator Wedding Card, Visiting Card, Typing eng, mar, guj, hindi,

    €18 - €147
    €18 - €147
    0 bud
    english project 2
    Udløbet left

    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

    €193 Average bid
    €193 Gns Bud
    1 bud

    fdfd fef sdfr sdfr grsdfvd rhwr gdg er gdv drt gtdvcg dhdfvcgf rd gdcg rgftgdrg fthftg dg dthg fthf hfyhft

    €22 Average bid
    €22 Gns Bud
    1 bud
    something written
    Udløbet left

    fdfd fef sdfr sdfr grsdfvd rhwr gdg er gdv drt gtdvcg dhdfvcgf rd gdcg rgftgdrg fthftg dg dthg fthf hfyhft

    €19 Average bid
    €19 Gns Bud
    1 bud
    Data Entry
    Udløbet left

    Typing , online form filling

    €10 - €29
    €10 - €29
    0 bud
    english revise
    Udløbet left

    ps revising personal statememt revising

    €414 Average bid
    €414 Gns Bud
    19 bud

    ...----------------------- Tekst om opskrift: Eksempel: "The meal consist of one cheese and olive Focaccia premade (I bet you could also make your own). A square is made in the middle of the bread so there is space for two eggs. The combo is topped with bacon and cress which add freshness and color to the breakfast/brunch recipe. This Focaccia egg and bacon food recipe is focused on making it with speed. Therefore this recipe will also learn you how to make bacon in the microwave......." (and so on) ----------------------- Ingrediensliste: 1 x Cheese and olive Focaccia premade bread 2 x Eggs 1 x Mango ..... o.s.v. ----------------------- En liste af hvordan opskrift udføres. 1 - Først tager du 2 - Så gør du 3 - N&ari...

    €96 Average bid
    €96 Gns Bud
    1 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' Translate website from english to italian'

    €35 / hr Average bid
    €35 / hr Gns Bud
    1 bud

    Voice over for Internet Marketing Tutorial Videos USA VOICE MALE

    €169 Average bid
    €169 Gns Bud
    7 bud

    ok thank youxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

    €29 - €242
    €29 - €242
    0 bud

    ok thank youxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

    €145 - €145
    €145 - €145
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €18 - €147
    €18 - €147
    0 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €69 Average bid
    €69 Gns Bud
    1 bud

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €105 Average bid
    €105 Gns Bud
    1 bud
    PROJECT OF TYPING
    Udløbet left

    gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR

    €105 Average bid
    €105 Gns Bud
    1 bud

    Jeg har vedvarende arbejde relateret til vores tidligere projekt ' English to Norwegian and Swedish'

    €10 / hr Average bid
    €10 / hr Gns Bud
    1 bud

    ...Form: A functional contact form so potential clients or employers can reach out to me. Blog Section (optional): A simple blog feature to post updates or share insights related to my field. SEO Optimization: Ensure the site is optimized for search engines to help it rank well. Social Media Integration: Links to my professional social media profiles (LinkedIn, GitHub, Instagram, etc.). Fast Loading Speed: The website should load quickly and efficiently. Content Management System (CMS): I’d prefer a CMS like WordPress, Webflow, or another easy-to-use platform so I can manage content after the site is built. Skills Needed: Experience in HTML, CSS, JavaScript, and modern web development frameworks. Familiarity with UI/UX design to create a visually appealing experience. Experien...

    €92 Average bid
    €92 Gns Bud
    39 bud

    I'm looking for an experienced English tutor to help improve my speaking skills. The focus will primarily be on casual conversations, so the ideal candidate should have a knack for creating comfortable, engaging, and interactive sessions. Skills and experience in teaching English as a second language, particularly at an intermediate level, will be highly valued. Please be prepared to share your teaching philosophy and methods, as well as any relevant qualifications or experience.

    €18 / hr Average bid
    €18 / hr Gns Bud
    4 bud

    I'm looking for a computer whiz with a knack for data typing jobs. The job primarily involves data entry from scanned documents, which can include both numerical and textual information. Ideal skills and experience for the job: - Proficient in data entry - Able to handle mixed data types (numerical and text) - Experienced in working with scanned documents, online database as well written documents. - High attention to detail - Fast and accurate typing skills

    €241 Average bid
    €241 Gns Bud
    90 bud

    ...Transform encoding (DCT/wavelets/learned transform). Motion estimation and prediction. Entropy coding. Output: Save the compressed file in a container format (e.g., MP4, MKV). >>>Step 6: Testing and Benchmarking Metrics to Track Compression Ratio: Measure file size reduction. Quality Metrics: PSNR (Peak Signal-to-Noise Ratio). SSIM (Structural Similarity Index). Performance: Encoding/decoding speed. Compatibility: Test across devices and platforms. Datasets Use publicly available datasets like Vimeo-90k or create your own. Tools FFmpeg for benchmarking. Tools like MSU Video Quality Measurement Tool for quality analysis....

    €469 Average bid
    €469 Gns Bud
    30 bud

    I need a professional web designer to improve the user experience of my site. The main focus areas will be: - Optimising loading speed: The site currently has some latency issues that need to be resolved. - Enhancing interaction: The site features several interactive elements, such as forms and widgets. These need to be made more intuitive and engaging. The ideal candidate for this project should have a strong background in UX design, web optimisation and interactive web elements. A portfolio showcasing previous website redesigns will be highly advantageous. We have a themealready from Themeforest, so i need you to copy the data across, make sure everything works ok. ******** DO NOT CALL US ABOUT THIS OFFER *************

    €396 Average bid
    €396 Gns Bud
    233 bud

    I need an SEO expert who can optimize my entire website, particular...covers on-page, off-page, and technical SEO - Proven ability to significantly enhance search engine rankings - A track record of improving website visibility on Google Skills: - In-depth knowledge of SEO - Proficient in Digital Marketing - Expert in Google Analytics - Skilled in Content Optimization - Excellent in Keyword Research Specific focus areas include: - Technical SEO improvements: Site speed optimization, Mobile-friendly enhancements, Indexing and crawling improvements - Content Optimization: Product descriptions, Metadata (titles and meta descriptions), Images and videos I am looking for someone who can not only improve my website's SEO but also provide a clear and actionable report on the progre...

    €39 Average bid
    €39 Gns Bud
    27 bud

    We are looking for a skilled freelancer to design and develop a WordPress website with a room booking plugin. The website should be fully bilingual (Arabic and English) and consist of up to 12 pages. The project requirements are as follows: Key Features: Room booking functionality with a plugin. Bilingual support (Arabic/English). Responsive and user-friendly design. SEO optimization for both languages. Integration with payment gateways for booking. Pages: Up to 12 pages, including Home, About, Services, Contact, and Booking. Additional Requirements: High-quality UI/UX design. Easy-to-manage backend for content updates. Integration of Google Analytics and social media links. SSL certificate setup for secure transactions. Timeline: Please specify the estimated time require...

    €147 Average bid
    €147 Gns Bud
    178 bud

    ...Prospects: Emerging trends (e.g., AI-assisted decision-making tools). Potential innovations in personalized medicine. Conclusion: Summary of key points. Final thoughts on balancing AI integration with ethical responsibility. This topic balances technology and healthcare, offers plenty of research material, and fits well into a 7-page high school research paper. It should be organized and well written. AFTER you are done writing, editing, and completing. You should publish it to a very reputable academic journal or publication. No business publications such as or etc. Please review by me before you publish....

    €115 Average bid
    €115 Gns Bud
    46 bud

    ... - Develop a responsive layout for mobile and desktop. - Implement a booking system with custom options for packages and add-ons. 3. **Payment Gateway Integration (15%)** - Integrate payment options like UPI, credit/debit cards, and wallets. - Test the payment flow for seamless transactions. 4. **Testing & Final Revisions (15%)** - Conduct testing for responsiveness, speed, and usability. - Make revisions based on feedback. 5. **Launch & Training (10%)** - Deploy the site to the live domain. - Provide documentation and basic training on how to update content. --- **Skills Required:** - Web Design & Development (WordPress, Custom CMS) - Booking System Integration - Payment Gateway Setup - UI/UX Design Expertise ...

    €104 Average bid
    €104 Gns Bud
    46 bud
    Animated Ad for Grocery App
    6 dage left
    Godkendt

    I'm seeking a skilled video producer and animator to create an engaging, animated advertisement for my grocery shopping app aimed at small towns. K...skilled video producer and animator to create an engaging, animated advertisement for my grocery shopping app aimed at small towns. Key Focus: - The primary aim of the video is to promote the app's features, particularly the easy ordering process and fast delivery options. - The animation should be captivating and clearly illustrate the app's user-friendly interface and its competitive delivery speed. Ideal Candidates: - Proven experience in creating animated advertisements. - Prior work with app promotion is a plus. - Strong portfolio demonstrating creativity and understanding of conveying complex information in a...

    €70 Average bid
    €70 Gns Bud
    17 bud

    ...to regain its original form, igniting a war centuries ago between humans and creatures later called vampires. These vampires—or rather, aliens—are now extinct, as humanity drove them to annihilation. Izaline gains forbidden knowledge of the outside world from a mysterious entity later revealed to be the devil. She is eventually rescued by a member of the clergy named Edward. I have 108 pages written...

    €14 / hr Average bid
    €14 / hr Gns Bud
    110 bud

    ...postgraduate project. The purpose of the assessment is to identify and rate hoarseness in the samples. Key Aspects: - Assessment of 68 voice samples for hoarseness using GRBAS scale - Provide a score summary with comments for each sample The most critical aspect of this project is overall accuracy of the assessments. Given the nature of the project, consistency across samples is also important. While speed of assessment is not as critical, timely completion of the assessments before the project deadline of October 31, 2025 is essential. Compensation will range from Rs. 150-250 for each sample assessed, based on your level of experience. The status of 'Expert Consulatnt' will be given in the dissertation work of this project. If you're interested, please don'...

    €147 Average bid
    €147 Gns Bud
    7 bud

    I need a professional translator to convert an approximately 800-page Marathi chargesheet into English. This translation is critical for legal proceedings, so it must be accurate and clear. Key Details: - The document is roughly 800 pages long. - Standard legal terms are used throughout the document, so a translator with a strong understanding of common legal jargon will be beneficial. - The translation does not need to be certified, but it does need to be of a high quality suitable for legal review. Ideal candidates for this project should: - Have extensive experience in translation from Marathi to English. - Be familiar with legal terminology and documents. - Be able to deliver a meticulous and high-quality translation within a reasonable timeframe.

    €15 Average bid
    €15 Gns Bud
    45 bud

    More details: What specific error or issue occurs when the test case fails in spring boot version 3.4.x? Test case assertion failure Which part of the test case is failing the assertion? Output/result verification Are there any changes in dependencies or libraries between spring boot version 3.3.x and 3.4.x? Yes, some dependencies were updated

    €60 Average bid
    €60 Gns Bud
    13 bud