What is a good typing speedJobs
I am trying to set up a tiling shop and have the product page and ordering process similar to: or What's important: - Price entry in the backend should be in m² - We should display the price of m² and the price of a box with its contents. - The visitor will enter the surface he needs, it will be rounded up to the next number of boxes that cover that area. - Or he will enter the number of boxes and see how much that is in terms of area. - Both fields are interconnected. - Show the total cost of his order. I will give you more details via chat if needed. I am really looking for someone with good english who can understand the
...specs for this project are Wordpress based / Editable in the backend of the site Fast in google page speed insights Goal is under 2 seconds on all pages WP rocket + CACHING + MINIMISE PICTURES Features Videos Picture slides Animation videos Editable text Editable pictures Editable blocks Editable logos Create unique URLS - SEO wise Design wishes 14 different logos containing the name of each “BRAND name” FIGMA only / UX optimizing just like on FIGMA project Requirements WORDPRESS BASED Able to connect up with our DIV - contact formular on - FROM OUR BACKEND DEVELOPER (RoR Ruby On Rails) It should always be possible to load external JS as the current one is based on, so I don't think they can make something that won't work with the type o...
Page speed for my website is so bad: I need this fixed. Plugins and website have to run the same way (unless we agree on disable).
The aim of the project is to fix a bug on causing all embedded YouTube-videos to stop playback when toggling full screen on mouseover. The videos should not stop on fullscreen-toggle. Only the mobile version of the site is affected. The videos affected are located here: etc.
...description Database to be run on Internet, with a small number of users, now 6 users. Login for each user, the database is not visible if you are not logged in. The database to be used for the creation and search of records. The information consists of standard personal data, address, and mail. Typing the postcode, the city name is found in an underlying base. Furthermore, there is the creation date / correction date 3 text fields and 2 dropdown field - and a note field. One drop down box shows the default login person (which is part of the drop down option) Searching is done on 3-4 fields individually, and results are displayed as list, which can be clicked on, as each result is displayed. The layout may be edit ...
Jeg skal have lavet min side, så den er så tæt på 100 som muligt her Samtidig skal jeg have lavet SEO på min side - Du SKAL have referencer når du byder på denne opgave.
for sale EMAILS skype:
...line appetitvækker: Eksempel: "Quick and delicious breakfast/brunch that lets you impress the people you serve it for" ----------------------- Tekst om opskrift: Eksempel: "The meal consist of one cheese and olive Focaccia premade (I bet you could also make your own). A square is made in the middle of the bread so there is space for two eggs. The combo is topped with bacon and cress which add freshness and color to the breakfast/brunch recipe. This Focaccia egg and bacon food recipe is focused on making it with speed. Therefore this recipe will also learn you how to make bacon in the microwave......." (and so on) ----------------------- Ingrediensliste: 1 x Cheese and olive Focaccia premade bread 2 x Eggs ...
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
Mit navn er Jonas og jeg er Webudvikler med mere end 7 års erfaring i branchen. * Primært fokus er Webudvikling (HTML/CSS, PHP, MySQL, JavaScript) * WordPress ekspert * Gennemtænkte løsninger, så du undgår unødvendig langtrukne projekter og ekstraarbejde * Kort leverings- og responstid (Haste opgaver er intet problem) * Kompetent rådgivning er vigtigere end øget salg (også selvom man er sælger)
Mit navn er Jonas og jeg er Webudvikler med mere end 7 års erfaring i branchen. * Primært fokus er Webudvikling (HTML/CSS, PHP, MySQL, JavaScript) * WordPress ekspert * Gennemtænkte løsninger, så du undgår unødvendig langtrukne projekter og ekstraarbejde * Kort leverings- og responstid (Haste opgaver er intet problem) * Kompetent rådgivning er vigtigere end øget salg (også selvom man er sælger)
i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you i love you
I'm seeking a professional web developer to create a comprehensive car parts catalog website. This platform should allow users looking to find specific parts for their vehicles. Our competitor's website is and you need to replicate that website. Data and images has to be scrapped from this website. Key Features: - Compatibility: The website should be mobile-responsive and also function seamlessly on desktops. - Search and Navigation: Users should be able to search for parts by their car model, part number, or browse through categories. - Extensive Catalog Support: The website needs to handle over 5 million car parts. - Speed: The website should load, browse, and search very fast. Additional Details: - Design: I don't have a specific d...
...computing, AWS migration, DevOps consulting, and innovative tech solutions. 2. Project Objective Purpose of the Website: To create a professional, modern, and responsive website that highlights our services, builds trust, and generates leads. Target Audience: Businesses seeking AWS migration or DevOps consulting. Startups and enterprises needing cloud solutions. 3. Website Requirements 3.1. Design Style Theme: Minimalistic, professional, and tech-focused. Inspiration: Clean layouts with blue and white tones (matching our logo). 3.2. Key Features Homepage: Hero banner with tagline (Empowering Ideas, Defining the Edge). Overview of services. Call-to-action (CTA) buttons: Get a Quote and Contact Us. About Us Page: Will be added later Services Page: Will be added later Contact...
I'm looking for a skilled typist who can accurately transcribe text from PDF files into a Word document. The primary task will be typing text from various PDF files into a Word document, ensuring that the transcription is accurate and well-formatted. Ideal candidates should have: - Proficiency in English typing. - Excellent attention to detail. - Experience with PDF to Word transcription. - Ability to meet deadlines.
I'm experiencing performance issues with a VBA code that processes text data. The code runs slower than expected, particularly during the data processing phase. Ideal Skills: - Proficiency in VBA programming - Experience with optimizing code for speed - Skilled in handling and processing text data Please provide your bid if you can help fix these performance issues.
As a Web Developer you will be responsible for building and maintaining our websites and web applications. You’ll work closely with our design, marketing, and product teams to ensure that we provide a seamless and engaging online experience for our users. Key Responsibilities: Develop, test, and deploy user-facing features for web applications. Build reusable code and libraries for future use. Ensure the technical feasibility of UI/UX designs. Optimize applications for maximum speed and scalability. Collaborate with back-end developers to integrate APIs and other services. Stay up-to-date with emerging web development trends and best practices. Troubleshoot and debug issues to ensure seamless performance. Participate in code reviews and contribute to team knowl...
I'm in need of a skilled typist to transcribe a financial report into a Google Word Document. The report will specifically focus on creating an Income Statement. Key Requirements: - Proficient in Google Docs - Excellent typing skills - Familiarity with financial terminology and report formatting Your task will be to accurately and efficiently transcribe the report, ensuring that all information is correctly presented. Please provide examples of similar projects you've completed in the past.
...are seeking a proactive and communicative individual to join our team as a Customer Support Specialist for a dating app. The primary responsibility of this role is to engage in real-time chats with users, offer personalized assistance, and promote travel opportunities with girls on various dating platforms. Key Responsibilities: • Engage in friendly, professional chats with users on dating apps. • Introduce and offer travel opportunities with girls to interested customers. • Ensure timely and courteous responses to inquiries. • Build rapport with customers while maintaining platform guidelines. • Provide feedback on user interactions to help improve customer experience. Requirements: • Strong written communication skills ...
Location: Farringdon London - Onsite - some remote Freelance/Contract (part-time) - may become full Time Start Date: ASAP Role Overview: We are seeking an experienced Network Firewall and Server Specialist to configure a firewall system and build/maintain high-performance servers. The primary objective of this role is to secure our network infrastructure and ensure smooth, fast operations for critical business processes. Responsibilities: - Configure and set up a firewall system to prevent unauthorized access to our network. - Secure various types of devices, including: - Workstations and laptops - Servers - IoT devices - Identify and mitigate network vulnerabilities by implementing proactive security measures. - Build and maintain high-perform...
I'm looking for a reliable freelancer to help me type a business report in Google Docs. Key Responsibilities: - Typing the document accurately - Applying detailed formatting including headings and bullet points - Creating an Executive Summary section Ideal Skills: - Proficient in Google Docs - Exceptional typing skills - Experience with business report formatting - Attention to detail
Vær venlig at Tilmelde dig eller Log ind for at se detaljer.
Creation of a copy-trading bot on Solana chains. Frontend website (domainname needs to be chosen) needs to be developed with the following options: - Login with 2-factor authentication (after creating an account, and Google Authentication) - Creation of a new Sol address. (on chain), when the user had created the account. This wallet will then be used to trade with after a deposit is made. - The user must have the possibility to withdraw/deposit in the user section of the account. Also, it must be possible to export the private key - The user needs to have the following options on the Copytrading tab/section: o Tag for the specific wallet which is copied. o Target Wallet Adress o Buy Percentage (of the initial wallet) o Max Buy: for example, 0.5 sol o Mi...
currently we are facing file upload timeout issue on high load iis website My IIS server is running a PHP 7 web application. The server has high performance and reasonable upload speed (over 200-300 MB/s), but it still takes forever to upload a file. Submitting forms, database queries and other operations run in a short time frame, however, uploading a file doesn't work and simply times out after a while. The server previously ran perfectly, however, the issue has started happening for the past 7-8 days when load increases I need an expert in IIS/Windows server configuration to troubleshoot the uploading process and resolve the issue. You should be able to work using Any Desk/Team Viewer or any other remote desktop solution.
I'm in need of a professional typist with attention to detail who can accurately transcribe forms and tables from PDFs into Google Docs Key Requirements: - Proficient in Google Docs - Excellent typing skills - Strong attention to detail - Experience with data entry and transcription - Ability to follow specific formatting instructions You'll be given PDFs containing forms and tables, which need to be typed out in Google Docs. The project is not as simple as just basic text and layout; specific formatting will be needed. A keen eye for detail and the ability to follow instructions is crucial for this task.
I need assistance with a PDF document which is primarily for research and information gathering. The document contains a mix of text, images, and charts. Some materials need to be sourced, so a degree of data gathering is involved. Ideal Skills and Experience: - Proficient in typing and data entry - Familiar with Google tools - Able to interpret and transcribe content from images and charts - Research skills to source some materials - Attention to detail
Vær venlig at Tilmelde dig eller Log ind for at se detaljer.
I need a freelancer who can extract data from structured tables in a PDF and input it into a spreadsheet. The ideal candidate should have experience in data entry and be proficient with Excel. Attention to detail is critical to ensure all data is accurately transferred.
Supersonic Unmanned Combat Aerial Vehicle (SUCAV) Background In the ever-evolving landscape of aerospace technology, the development of Supersonic Unmanned Aerial Vehicles (UAVs) stands as a testament to human innovation and the quest for achieving unprecedented speed and efficiency in aerial operations. These cutting-edge vehicles, capable of traveling at speeds exceeding the sound barrier, have emerged as a new frontier in military aviation, promising groundbreaking advancements in reconnaissance, surveillance, and combat capabilities. The need for supersonic UAVs stems from the rapidly changing nature of modern warfare. In an era where agility, precision, and rapid response are paramount, supersonic UAVs offer unparalleled strategic advantages. These vehicles can sw...
I'm looking for a bilingual (English-Hindi) translator with experience in voice over scripts. The project involves translating English voice over content into Hindi. Please provide past work samples if available.
Vær venlig at Tilmelde dig eller Log ind for at se detaljer.
...Development of a High-Speed US Coin Identification and Detection System (Hardware + Software Integration) --- ### **Project Description** I am seeking an experienced software developer to collaborate on building a **high-speed US coin identification and detection system**. This system will integrate both hardware and software components to analyze coins for **key dates** and **mint errors**. I will handle the hardware development but will work closely with the software developer to ensure seamless integration throughout the project. --- ### **Project Objectives** 1. **Coin Identification**: Develop software that can analyze coins (front and back) using high-tech cameras at high speed. 2. **Key Date and Mint Error Detection**: The sof...
Project Overview: Healthcare AI Foundation Website Development 1. Introduction This project involves building a comprehensive website for the Healthcare AI Foundation, an organization dedicated to advancing healthcare through artificial intelligence. The website will serve as a central hub to showcase the foundation's mission, projects, research, and impact. The project requires a blend of technical expertise, creative design, and a human-centered approach to communicate effectively with various audiences. 2. Project Goals Establish a Professional Online Presence: Create a visually appealing and credible online platform for the Healthcare AI Foundation. Communicate the Foundation's Mission: Clearly convey the foundation's dedica...
I'm in need of a social media manager for my Instagram account. The role includes creating content for Instagram Posts, Stories, and Reels, as well as basic video editing for the content. Ideal Skills and Experience: - Proven experience managing Instagram accounts - Creative content creation - Basic video editing skills (cut, trim, add music) - Fast typing
I'm seeking a professional to enhance the loading time of my WordPress site, with a focus on the following aspects: - All Devices: The site needs to be optimized for mobile, desktop and tablet. - Critical Pages: The speed enhancement should primarily target the homepage and blog pages. Your expertise should ideally include: - Experience in WordPress speed optimization. - Proficiency in identifying and fixing server response time issues. - Skills in improving page interaction speed. Please provide a detailed proposal on how you plan to achieve these improvements.
The project involves structuring the site to follow a logical hierarchy: Country > State > City > Neighborhood > Property. Additionally, related properties within the same neighborhood and blog articles with similar topics should be linked dynamically. All adjustments should adhere to SEO standards and enhance the user experience. Key Requirements Internal Links and Breadcrumbs: Set up internal links following the hierarchy: Country > State > City > Neighborhood > Property. Properties should dynamically display links to related listings within the same neighborhood. Blogs should include links to articles on similar topics. Technical SEO: Implement schema markup for property pages, blog articles, and other sections of the site. Ensure all URLs are SEO-frien...
I'm seeking a professional for a dual task: 1. Website Design: The primary aim of the website is to facilitate multi-step forms and incorporate file upload capabilities. As such, you should have experience in designing user-friendly, intuitive websites with these specific features. Your design should prioritize simplicity and functionality, catering to users of all skill levels. 2. Data Entry: This task involves document transcription. The selected freelancer should possess excellent typing skills, a keen eye for detail, and experience in transcribing various types of documents accurately and efficiently. Your bid should reflect your experience in web design and data entry, particularly document transcription. Please provide examples of similar p...
We are seeking a highly skilled React developer to join our team on a contract basis to help improve our main user-facing application. Key Responsibilities: - Enhancing user interfaces to deliver exceptional user experiences. - Improving application performance to ensure scalability and speed. - Seamlessly integrating with APIs and WebSocket services for real-time functionality. - Adding new features to keep the application fresh and engaging. - Managing state efficiently for a smooth user experience. Ideal Skills and Experience: - Proven track record in React development. - Strong understanding of building performant and scalable applications. - Hands-on experience delivering impactful React projects. - Experience with WebSocket integration for real-time fea...
Here is my website checklist for a transport manager services: offering external transport management, internal audit support, system and driver training, and Driver CPC training; operator license applications: I have a base templeate i have been working on for a freelancer to expand on. 1. Domain and Hosting • Choose a professional domain name (e.g., ). • Purchase the domain and hosting plan (e.g., GoDaddy, SiteGround, Bluehost). • Secure an SSL certificate for data security. 2. Website Platform and Design • Select a platform (e.g., WordPress for flexibility, Wix for simplicity). • Choose a professional, transport-themed template. • Customize the layout to prioritize key services and ease of navigatio...
