Typing speed proficiencyJobs
...failing. - **ESP32 Background Information:** I'm using an ESP32 Development board for this project. The application running on this hardware was developed using Arduino. - **Necessary Skills Most Needed:** A freelancer with advanced knowledge of ESP32 and an understanding of the OTA process including familiarity with encrypted firmware updates will be best suited to tackle this issue. Proficiency in Arduino is also necessary. Given that this project deals with the inability to update firmware remotely, familiarity with networking would be an added advantage. Connecting to XXX W (84) wifi: wifi nvs_open fail ret=4353 E (84) wifi: wifi_init 1410 ret=4353 [E][] wifiLowLevelInit(): esp_wifi_init 4353 W (87) wifi: wifi nvs_open fail ret=4353 E (90) wifi: wifi_init...
...video explainer is to introduce my product/service to potential customers. - I do not have an existing script or narrative, but I have a rough idea of what I want to convey. - The video length required is 1 minute. Ideal Skills and Experience: - Strong scriptwriting skills to create a compelling and engaging script. - Experience in creating video explainers for product/service introductions. - Proficiency in video editing and animation software to bring the script to life. - Creativity and ability to turn rough ideas into a visually appealing and informative video. If you have the skills and experience required, please submit your proposal with examples of your previous work in video explainers.
The specs for this project are Wordpress based / Editable in the backend of the site Fast in google page speed insights Goal is under 2 seconds on all pages WP rocket + CACHING + MINIMISE PICTURES Features Videos Picture slides Animation videos Editable text Editable pictures Editable blocks Editable logos Create unique URLS - SEO wise Design wishes 14 different logos containing the name of each “BRAND name” FIGMA only / UX optimizing just like on FIGMA project Requirements WORDPRESS BASED Able to connect up with our DIV - contact formular on - FROM OUR BACKEND DEVELOPER (RoR Ruby On Rails) It should always be possible to load external JS as the current one is based on, so I don't think they can make something that won't work with the type of solution we...
Page speed for my website is so bad: I need this fixed. Plugins and website have to run the same way (unless we agree on disable).
Database description Database to be run on Internet, with a small number of users, now 6 users. Login for each user, the database is not visible if you are not logged in. The database to be used for the creation and search of records. The information consists of standard personal data, address, and mail. Typing the postcode, the city name is found in an underlying base. Furthermore, there is the creation date / correction date 3 text fields and 2 dropdown field - and a note field. One drop down box shows the default login person (which is part of the drop down option) Searching is done on 3-4 fields individually, and results are displayed as list, which can be clicked on, as each result is displayed. The layout may be edit via CSS. The database must be a SQL database. Th...
Jeg skal have lavet min side, så den er så tæt på 100 som muligt her Samtidig skal jeg have lavet SEO på min side - Du SKAL have referencer når du byder på denne opgave.
...----------------------- Tekst om opskrift: Eksempel: "The meal consist of one cheese and olive Focaccia premade (I bet you could also make your own). A square is made in the middle of the bread so there is space for two eggs. The combo is topped with bacon and cress which add freshness and color to the breakfast/brunch recipe. This Focaccia egg and bacon food recipe is focused on making it with speed. Therefore this recipe will also learn you how to make bacon in the microwave......." (and so on) ----------------------- Ingrediensliste: 1 x Cheese and olive Focaccia premade bread 2 x Eggs 1 x Mango ..... o.s.v. ----------------------- En liste af hvordan opskrift udføres. 1 - Først tager du 2 - Så gør du 3 - N&ari...
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
I'm looking for a seasoned web developer to create a robust e-commerce website on the WooCommerce platform. The site should provide an excellent user experience, featuring: - Product Search and Filtering: Customers should be able to easily navigate thro...Reviews: A section for customer feedback on products is essential. This will help build trust and authenticity on our platform. The ideal freelancer for this project should have: - Extensive experience in WooCommerce and e-commerce website development. - Strong skills in web design and user experience. - Ability to integrate and manage customer review systems and product search features. - Proficiency in implementing SEO best practices to enhance site visibility. If you possess these skills and experiences, I would love to...
I'm looking for a logo that embodies a modern and minimalist style. The logo should be a combination mark, meaning it will include both text and a symbol. It should be designed using neutral tones. Ideal skills and experience for this job include: - Strong graphic design skills...a combination mark, meaning it will include both text and a symbol. It should be designed using neutral tones. Ideal skills and experience for this job include: - Strong graphic design skills, particularly in logo creation - Experience with modern and minimalist design principles - Ability to create a cohesive combination mark - Expertise in using and understanding neutral color palettes - Proficiency in relevant design software (e.g., Adobe Illustrator, CorelDRAW) Please include a portfolio of rele...
I'm looking for a freelancer to assist with running day to day in a restaurant. The tasks will include updating the POS system (Lightspeed) with menu items, using Canva to ensure everything aligns with the restaurant's branding, and helping with rosters and tracking back-end costings. Ideal candidates should have: - Previous experience in restaurant management - Proficiency in using POS systems, particularly Lightspeed - Skills in graphic design and use of Canva - Ability to create and update rosters - Experience in tracking back-end costings - Understanding of labor, inventory and overhead costs
I'm seeking an engineering designer to create manufacturing-ready drawings for a glass Beverages bottle. The design should incorporate measurement markings engineered drawings. Skills and experience needed: - Proficiency in engineering design with a focus on glass manufacturing - Experience in designing glass beverage bottles - Ability to incorporate specified features into designs - Knowledge of creating designs suitable for mass manufacturing - Strong attention to detail and precision in creating measurement markings
I'm seeking a developer to create a user interface for a trading platform based on a provide...In addition to these primary features, the UI will also need: - Customizable dashboards: Users should have the ability to tailor their dashboards according to their preferences. The UI needs to be compatible with: - Desktop, Mobile, and Tablet: The interface should be responsive and optimized for a seamless experience across these devices. Ideal skills and experience for the job include: - Proficiency in UI/UX design, with a special focus on trading platforms. - Strong skills in front-end development and experience working with APIs. - Experience in creating responsive designs for multi-device compatibility. - Ability to implement features like real-time data display and user portfo...
I’m looking for an experienced Shopify developer to assist in updating, maintaining, and extending 4 to 5 of my Shopify sites. Key Responsibilities: - Implement design changes across various site areas - Add new features, primarily client order tracking - Troubleshoot and fix bugs in a timely manner Ideal Skills: - Proficiency in Shopify development If you have a keen eye for design and a knack for troubleshooting, I would love to hear from you.
I'm seeking a reliable individual who can handle customer support phone calls in English for my clients based in Japan. Th...individual who can handle customer support phone calls in English for my clients based in Japan. This is a test project, but if your performance is satisfactory, I would like to keep hiring you for future projects. Key Responsibilities: - Make calls within Japan to assist with customer support inquiries. - Provide information on order status as needed. Requirements: - Basic conversational proficiency in English is required. - Ability to make phone calls to Japan without any issues. - Prior experience in customer support or call handling is preferred. Please only bid if you can make calls to Japan. I will need to confirm whether calls are possible bef...
...AdSense for monetization. Scope of Work: SEO Optimization: SEO Audit: Conduct a comprehensive analysis of the website's current SEO performance. Keyword Research: Identify the most effective and relevant keywords for , focusing on Afghanistan news. On-Page SEO: Optimize meta titles, descriptions, header tags, internal linking, and content structure. Technical SEO: Address website speed, mobile responsiveness, and proper indexing by search engines. Fix sitemap issues and implement schema markup. Off-Page SEO: Build high-quality backlinks from authoritative sources and develop a link-building strategy. Website Design Enhancement: Redesign the website to make it more user-friendly, visually appealing, and engaging for readers. Ensure the design is mobile-optimized and offers...
I'm looking for a skilled web designer to create a blogger website for me, with a specific focus on delivering news and updates. Key Requirements: - The website should be designed for easy navigation and readability, with a layout suitable for a news blog. - The design should be responsive and mobil...and mobile-friendly, given the increasing number of users accessing news on their mobile devices. Special Features: - The website needs a comment section for readers to engage with the content and share their opinions. Ideal Skills and Experience: - Proven experience in designing blogger and news-oriented websites. - Strong understanding of UI/UX principles, particularly for news content. - Proficiency in HTML, CSS, and JavaScript. - Experience with SEO principles to enhance s...
I'm in need of a professional web developer with solid SEO expertis...expertise, particularly in on-page SEO, to help generate leads for my business. Key Responsibilities: - Optimize my landing pages for SEO to improve visibility and attract potential leads. - Implement effective lead generation strategies through web development and SEO. - Develop and optimize high-quality content, such as blog posts and articles, to improve SEO and attract leads. Ideal Skills: - Proficiency in web development. - Strong understanding and experience in on-page SEO. - Proven track record in lead generation. Please provide examples of your previous work in your proposal, particularly any related to lead generation and SEO. The primary goal is to increase sales through effective lead generat...
I'm seeking a professional to install and host a corporate website on an AWS server. The project entails setting up a Laravel backend as the content management system (CMS) for the site. Key Requirements: - Expert knowledge and experience with AWS server setup and management. - Proficiency in Laravel with a strong portfolio of corporate websites. - Ability to ensure smooth CMS functionality for easy content management. - Excellent communication skills for project updates and potential advice on best practices. Please provide examples of similar projects you've completed in your proposal. Thank you.
Description: We are looking for an experienced frontend d...js and Tailwind CSS. The pages need to be responsive, well-structured, and designed for optimal performance across devices. Key Responsibilities: - Develop 3 pages based on provided designs or requirements. - Implement responsive layouts using Tailwind CSS. - Ensure high performance and cross-browser compatibility. - Integrate React.js components with clean, reusable code. Requirements: - Proficiency in React.js and Tailwind CSS. - Strong understanding of responsive design principles. - Ability to write clean, maintainable, and scalable code. - Experience with Git for version control. We are eager to collaborate with a talented developer who can deliver high-quality results. If this sounds like you, send in your applicat...
...comprehensive display of our APIs, detailing their functionality and use cases. - A pricing page that outlines the cost of API keys, with a clear, user-friendly layout. - A purchasing system integrated with either PayPal or Stripe, ensuring secure and seamless transactions. - An interactive page where users can recommend additional APIs, fostering community engagement and input. Ideal Skills: - Proficiency in web development and design, with a strong portfolio of modern, minimalist websites. - Experience with e-commerce integration, particularly with PayPal and Stripe. - Ability to implement interactive features, enhancing user engagement. - Understanding of API functionality, ensuring accurate representation on the site. Please provide examples of relevant past projects in you...
I'm developing an auto car wash service and require a marketing strategy aimed at local car owners. The key selling point of this service is the speed of service. Key Requirements: - Development of a comprehensive marketing strategy - Focusing on local car owners as the target audience - Emphasizing the speed of service as the main benefit Ideal Skills: - Experience in local marketing - Understanding of the auto service industry - Ability to create engaging, targeted marketing content We need a presentation to be done
I need an experienced developer to convert my existing Flutter/Dart code which already builds as an Android App into an iOS app, with a primary focus on refining the user interface. Additionally, I require the implementation...Email/Password Authentication system for the web app, utilising either Firebase or AWS. Key Requirements: - Transform the current Flutter/Dart app into a polished iOS app - Create a secure authentication system for the web app, using the Email/Password Authentication method. - No existing security protocols need integration. Simply follow industry best practices for security. Ideal Skills: - Proficiency in Flutter and Dart. - Experience in iOS app development. - Familiarity with Firebase and AWS. - Strong understanding of security best practices in web authe...
I need someone to convert my handwritten notes, written in both Bengali and English, into an Excel spreadsheet. The task involves not just transcription, but also proper typing and formatting to ensure the data is organized and easy to read.
...in the official Telegram app. Key Requirements: Speed & Efficiency: The solution must prioritize speed and deliver messages as close to real-time as possible. Explore advanced techniques and optimizations for maximum performance. API Approach: Avoid traditional frameworks like Telethon or Pyrogram unless proven to be fast enough for the use case. Direct implementation of MTProto (Telegram’s protocol) is highly encouraged to bypass potential bottlenecks from middleman libraries. Message Retrieval: Retrieve messages from both public and private channels where we are not admins. Handle high-volume channels efficiently. Technical Expertise: In-depth knowledge of Telegram’s MTProto protocol. Experience with low-latency API design. Proficiency in hig...
I'm in need of a seasoned resume writer who can craft a professional, ATS-friendly and optimized resume for a mid-level position. The resume should be a combination of traditional text and an infographic. Infographic Elements: - Skills Chart: This should visually represent my skills in a clear and appealing manner. - Profe...clear and appealing manner. - Professional Timeline: I want my career journey to be depicted in a concise and engaging timeline. - Key Achievements: My significant accomplishments should be highlighted in a way that they stand out. Ideal Skills and Experience: - Proven experience in resume writing, particularly for mid-level positions - Strong understanding of ATS optimization techniques - Proficiency in creating engaging infographics - Excellent resume...
... expenses, billing accuracy, and other financial metrics critical to decision-making. • Process Improvement: Proactively suggest efficiency improvements and solutions for automating financial workflows. ________________________________________ Required Skills and Qualifications • Accounting: Intermediate foundation in accounting principles, financial reporting, and data analysis. • Software Proficiency: STRONG EXPERIENCE with tools such as QuickBooks, and be confident in learning to extract data from , , and other financial software. Familiarity with third-party integration tools • Critical thinking and Problem Solving skills • Tech-Savvy: MUST HAVE STRONG EXPERIENCE with automation tools and platforms that integrate multiple systems for seamless reportin...
I'm looking for a seasoned social media manager to handle my medical practice's online presence on Facebook and Instagram. Responsibilities: - Create engaging and relevant content including educational posts, promotional material, and patient testimonials. - Produce and post videos. Requirements: - Proven experience in social media management, preferably in the medical field. - Proficiency in video production and editing. - Strong understanding of Facebook and Instagram algorithms and trends. I aim for a professional yet approachable image online, with the goal of educating our community and promoting our services.
I need a Radius Manager that encompasses user authentication and access control, billing and accounting, as well as network monitoring and reporting. Key Requirements: - Rob...to keep track of user payments and generate invoices. - Detailed network monitoring and reporting: This should provide real-time data on network usage and possible issues. Platform Compatibility: - The Radius Manager needs to be compatible and seamlessly integrate with Linux. User Interface: - The Radius Manager must feature a user-friendly Graphical User Interface (GUI). Ideal Skills: - Proficiency in Linux and Radius server configuration. - Extensive experience in developing network management software. - UI/UX design skills for creating a comprehensive GUI. - Knowledge in implementing billing systems in...
I need a professional to help set up my Juniper EX3200 switch. The primary goal is to expand my network capacity. This setup will be crucial for accommodating my growing network demands. Skills and Experience: - Proficiency in configuring Juniper EX3200 switches - Networking expertise, particularly in expanding network capacity - Previous experience with network device setup - Understanding of VLAN configuration (though not needed for this project, it's a plus) Please note that the specifics of which devices the switch will need to connect to were not determined yet, so flexibility and adaptability are key.
I require a skilled professional to facilitate the integration of SQL Server with my Unity project. This involves setting up a periodic data sync specifically for game state data. Key Responsibilities: - Establish seamless periodic syncing of game state data between Unity and SQL Server. - Ensure data integrity and timeliness during the syncing process. Ideal Skills: - Proficiency with SQL Server and Unity. - Experience in game development and data management. - Strong problem-solving skills to troubleshoot any potential issues during the setup.
I'm looking for an experienced Shopify developer with proficiency in Shopify Flow to help streamline my store's operations. The primary task involves developing a Shopify flow trigger to automate filters from prefix tags to metafields. Key Requirements: - Shopify Flow expertise: The primary goal is to develop a Shopify Flow trigger that moves anything with specific prefix tags to metafields for filteration for our customers in our shopify store. - Filter Automation: I need help automating filters. These filters will primarily be based on metafields, so a deep understanding of metafield application and manipulation within Shopify is essential. - Shopify Development Skills: Strong Shopify development skills are necessary to implement and troubleshoot any issues that arise ...
I need a skilled image editor to place a specific photo of a man wearing a hat to the right of a tall guy in an image. Requirements: - Deliver the final image as a digital file in JPEG/PNG format. - Maintain the existing background of the image, which is a normal setting. - Keep the original quality of the image without enhancements or alterations. Ideal skills for this job include: - Proficiency in image editing software (e.g., Adobe Photoshop). - Attention to detail to ensure the placement looks natural. - Ability to deliver high-quality work within a set timeframe.
I'm looking for an expert to migrate my Kajabi content over to my GoDaddy site. This includes: - Community memberships - Journal workbooks - 1:1 Peer Recovery Mentoring In addition to the migration, I need help setting up backend automations and funnel...Recovery Mentoring In addition to the migration, I need help setting up backend automations and funnels on GoDaddy. This will eventually extend to building out a app. Ideal skills for this project include: - Extensive experience with both Kajabi, GoDaddy, WordPress, app - Proficiency in setting up backend automations and funnels - Knowledge in building apps - Strong attention to detail - Excellent communication skills -CRM management -SEO & Website Proficiency for Searchability and Sales
...2. Hosting Setup • Set up hosting for the MERN application on OVH. • Ensure compatibility with the requirements of the MERN stack. • Optimize hosting for scalability, speed, and reliability. 3. HTTPS with Paid SSL • Procure and configure a paid SSL certificate for the application. • Set up HTTPS to ensure secure communication. 4. Domain Binding • Bind the domain to the hosting setup. • Ensure proper DNS configuration for seamless domain routing. Skills and Experience: • Strong experience with OVH servers and hosting. • Expertise in MERN stack deployment and server configuration. • Proficiency in managing SSL certificates and implementing HTTPS. • Knowledge of DNS management and domain binding. • Fa...
I need an experienced PCB designer to develop a cost-effective PCB for me. This PCB should: - Communicate using Modbus RTU - Read data from 3 Modbus RTU Slave registers, with each slave having 5-10 Modbus Registers - Convert all read d...with each slave having 5-10 Modbus Registers - Convert all read data into HART protocol (specifically HART 5) The primary function of this PCB will be monitoring, so the design should be tailored for efficient data tracking. Additionally, the PCB will need to be powered by a DC source, so the design should account for this. Ideal skills for this job include: - PCB design and development - Proficiency in Modbus RTU communication systems - Expertise in HART protocol conversion - Experience with DC-powered devices - Ability to create cost-effective...
Short Video Ad Creation fo...software services, recruitment processes, and success stories to engage our audience effectively. Details: Video Length: Up to 45 seconds Content Focus: Company profile, services, client success stories, and industry highlights Style: Eye-catching, professional, and engaging with animations and text overlays Budget Per Video: ₹350-₹450 Requirements: Experience in creating compelling video ads Proficiency in motion graphics and animations Strong storytelling and branding skills Timely delivery of high-quality work Deliverables: Polished video ads ready for use on social media and other platforms Revisions as needed to align with project goals If you have a knack for creating engaging video ads and can deliver within our budget, we’d love to hear...
I'm looking for a talented video editor to help me cut and polish a short fi...enhance its humor and pacing. Key Responsibilities: - Edit the footage to create a seamless, engaging narrative - Incorporate special effects where needed to amplify the comedic elements - Add background music that complements the film's tone - Insert text annotations and captions at appropriate moments Ideal Skills and Experience: - Proven experience editing short films, particularly comedies - Proficiency with video editing software - Ability to create and incorporate special effects - Understanding of comedic timing and pacing - Experience with adding and selecting suitable background music - Skill in creating engaging text annotations and captions Please provide examples of similar projec...
I need a skilled Photoshop professional to help me modify a photo. Requirements: - Remove my son from the photo with the WWE superstar - Replace my son with his friend from another photo I will provide. The photo has a complex/mixed background, so the editing needs to be seamless and convincing. Ideal skills and experience: - Excellent photo editing and retouching skills - Proficiency in Adobe Photoshop - Experience with complex background editing - Attention to detail to ensure a natural looking replacement Please provide examples of similar work you have done in the past. Thank you!
I'm in need of a talented manga artist who specializes in traditional manga style to help create 4-6 unique characters for my comic book. Ideal Skills: - Proficiency in traditional manga-style illustration - Experience in creating comic book characters - Understanding of character design and development Looking for an artist who can bring these characters to life with their unique personality and style fitting for a comic book. A portfolio showcasing similar work will be highly advantageous.
Vær venlig at Tilmelde dig eller Log ind for at se detaljer.
