Third law of motionJobs
I am in need of webscraping services for Danish Law. Specifically, I would like the data to be scraped from Danish law websites. No translation is necessary as I plan to use the data in Danish. Additionally, I would prefer that the data be directly imported into a database for my use. If you have experience with Danish legal webscraping and are comfortable with this project, I am eager to work together to get this project accomplished. The deliverables are code, sub-domain URLs from three websites + the scraped content. The target web-sites are , and
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq"...com","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You ca...
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Hi, We need general text about flights. Written in simple, understandable sentences. Length: 3000 signs with spaces or 450 words Theme: 4 paragraphs about 1. Travel by plane - it’s safe, fast, cheap and comfort 2. When is the best moment for ticket reser...continental and intercontinental) and others. 4. What can I take to plane (to hand luggage)? (eating, drinks and others) What we want: • We like keywords: cheap flights, cheap tickets. It would be great if you will use them two or three times. It’s nice, but not necessary. What we want avert: • Please don’t use brands online travel agency, flight search engines. You may use brand of the most popular airlines in third paragraph. • Please don’t write about something terri...
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
We want Remote Desktop software (for Mac & Win) like Team Viewer with all its functionality. Please send us ALL THE FEATURES and specification of what you will be providing. Along with the FINAL PRICE Note: 1. Complete and PROPER Source Code with documentation required. 2. No Copyright Script or GPL script. 3. No third-party tools.
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Jeg leder efter en der er i stand til at lave en introduktion til min livestream på som vil blive brugt til når jeg starter og slutter. Jeg vil helst have at intro'en er loopable, hvilket derfor også betyder at det ikke skal være noget overvældende langvarigt arbejde. Det skal gerne bare være noget, med noget motion. For eksempel min kanals navn med noget motion. (Jeg har ikke meget erfaring med faget så vi må komme nærmere på detaljerne når vi snakker sammen omkring det, da jeg ikke ved hvordan jeg skal forklare mig.)
domain / hosting / google apps / website transfer for client
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I'm in need of a legal professional skilled in contract law to draft an employment contract for a managerial position. The contract must be comprehensive, fair, and legally sound to protect both the company and the employee. Ideal Skills and Experience: - Extensive knowledge in crafting employment contracts - Understanding of managerial level expectations and requirements - Proficiency in contract law and legal language
We have set of 400 images which need to be annotated and labeled. We are using a third-party tool called VIA(VGG Image Annotation) Tool. You will work on your web browser by accessing to our interface page. We use VIA(VGG Image Annotation) Tool ~vgg/software/via/ Each image has 5 labels. You will mark the region by clicking the border of objects in images (not by bounding box), then set a label name to each region. We assume a single image annotation will take 3 to 4 minutes. So the total project should take 20 hours to 26 hours. You will need to export the labeling data and send us once the work is done. Please bit with amount and time to delivery. Once selected, will provide access to the interface and our how-to page. Once satisfactory work is performed, I
I have approximately 56 pages of content in PDF format that needs to be typed out into a .doc file. This document needs to be formatted as a court document, complete with line numbers, footnotes, and other necessary legal formatting elements. The PDF includes all formatting; I need you to replicate it in .doc. Specific requirements include: - Using Georgia, 13pt font throughout the document. - Including both headers and footers in the document, as well as footnotes - Consistently and accurately replicate the citations, including subsection symbol Ideal candidates for this project will have experience with legal document formatting and a strong attention to detail. Please ensure you have a good command of typing and document formatting software. The .pdf is attached....
...strategy, and requirements. ? Tasks for Business Analyst: ✔ Expand vision, market analysis, revenue model, and success metrics. ✔ Add competitor analysis and industry trends. ✔ Define feature differentiation across user segments. ✔ Include a detailed monetization strategy covering pricing models, feature-based billing, and revenue projections. ✔ Define all feature sets, including detailed descriptions of workflows and system interactions. ✔ Update user types and roles based on operational needs. ✔ Structure development phases, timelines, dependencies, and risk management strategies. ✔ Develop a release plan covering MVP, beta testing, and full launch. ? Deliverables for BRD & Project Plan: ✅ Updated BRD with a complete monetization strategy. ✅ Feature sets categorized by pl...
I have a basic rules file edited in notepad or similar. I would like to duplicate and modify the rules (name, 5 conditions and 2 values) into the duplicated rules. I have all the data that needs inputting in an excel table. I am happy to enter the require...happy to enter the required data but am looking for a tool that will create/edit the rules file with the desired amounts. I have a rules file in notepad that needs to be rewritten into an Excel file. The rules are conditional formatting rules and are relatively simple. The data in the notepad file is structured as plain text with delimiters. Ideal Skills: - Proficiency in Excel - Understanding of conditional formatting rules - Ability to interpret plain text with delimiters Experience in data entry and conditional formatting ...
...scalability. Important Notes ✅ The mobile application is NOT a necessary deliverable—our team can develop it if the necessary APIs are provided. ✅ We are open to better technology and platform recommendations based on expertise. ✅ By “local AI,” we mean a cloud-based private AI instance—we are NOT looking to set up or manage on-premise hardware. ✅ We need a long-term strategy to reduce dependency on third-party AI models by gradually transitioning to our own. ✅ The AI system must detect and filter out irrelevant or inappropriate requests that do not align with platform functions. Core Functionalities The AI assistant should handle: ✅ Context-aware information retrieval – Understanding queries and fetching relevant data. ✅ AI-driven summarization...
I'm seeking an LLB graduate with a strong understanding of Indian law, specifically in Criminal Law. The focus of this project will be on Civil and Criminal Procedure, so familiarity with this area is crucial. Key Responsibilities: - Conduct comprehensive legal research on Criminal Procedure within Indian Criminal Law. - Summarize relevant case law for easy understanding and application. Ideal Candidate: - LLB Graduate with deep understanding of Indian Law. - Strong research and analytical skills. - Proven experience with case law summaries. - Excellent written communication skills.
I'm in need of a talented visual artist who can create a standout traditional-style illustration centered around cultural heritage and history. This piece will be used for a personal project, so it must be unique and high-quality. Key Requirements: - Expertise in traditional illustration techniques - Deep understanding and appreciation of cultural heritage and historical themes - Ability to create captivating, high-quality illustrations Ideal Skills: - Strong portfolio of traditional illustrations - Excellent communication skills - Ability to meet deadlines and deliver high-quality work If you can transform my vision into a stunning piece of art, please get in touch.
...strategy, and requirements. ? Tasks for Business Analyst: ✔ Expand vision, market analysis, revenue model, and success metrics. ✔ Add competitor analysis and industry trends. ✔ Define feature differentiation across user segments. ✔ Include a detailed monetization strategy covering pricing models, feature-based billing, and revenue projections. ✔ Define all feature sets, including detailed descriptions of workflows and system interactions. ✔ Update user types and roles based on operational needs. ✔ Structure development phases, timelines, dependencies, and risk management strategies. ✔ Develop a release plan covering MVP, beta testing, and full launch. ? Deliverables for BRD & Project Plan: ✅ Updated BRD with a complete monetization strategy. ✅ Feature sets categorized by pl...
...looking for an assistant speaking in Polish to help organise a conference focused on HR and Labor Law. We are seeking a detail-oriented and proactive freelancer to assist in content search and organizing conferences in Poland, with a focus on HR and labor law. This role is perfect for someone with a passion for research and a solid understanding of the HR and labor law landscape, particularly in identifying key speakers and trending topics in the field. The primary responsibilities will involve researching relevant content to be presented at the conference. Ideal skills and experience for the job include: • Content Research: Identify the most popular and influential speakers in the HR and labor law sectors. Analyze the topics these speakers addre...
I need a professional to draft a residential purchase-sale contract according to Peruvian laws. The contract will be between an individual buyer and seller. The contract should include specific clauses such as payment terms, property condition, and confidentiality. Ideal Skills: - Extensive knowledge of Peruvian property law - Experience in drafting residential purchase-sale contracts - Ability to incorporate specific clauses into contracts Key Responsibilities: - Drafting a legally sound and comprehensive purchase-sale contract - Ensuring the contract is tailored for an individual buyer and seller - Including specified clauses in the contract Please share your relevant experience and provide a quote for this project. Thank you!
i have this group picture. I need to add more sky space on top to make the picture vertical not horizontal. So after the edit, the top half of the picture will be sky, and the bottom half to be the same. I need the picture to seems like natural without edits
Automation of Amazon re-orders - I will add link to system and system will place order as much i want, after that there will be report about order numbers.
I'm in need of a skilled developer for a project focused on creating and integrating a GraphQL API. Key Responsibilities: - Develop a GraphQL API that primarily focuses on data retrieval. - Ensure seamless interaction between the API and various data sources including our database and multiple third-party services. Ideal Skills: - Proficient in GraphQL API development. - Experienced in API integration with databases and third-party services. - Strong understanding of data retrieval processes.
Project Overview: We are looking for an experienced WordPress & WooCommerce freelancer to help us set up and customize our e-commerce website. The goal is to create a fully functional, visually appealing, and user-friendly online store where customers can easily browse and purchase our stone-based tiles / bricks. 1. Theme Installation & Setup 2. WooCommerce Setup & Customization 3. Design & Customization 4. Payment & Shipping Integration 5. Performance & SEO Optimization 6. Essential Plugins & Security Setup • Install Yoast SEO or RankMath for SEO • Install Wordfence or Sucuri for security • Set up Google Analytics & Facebook Pixel
Check below what details I want to add in Partner app.
Nous souhaitons donner du professionnalisme a cette fiche produit, nous vous liaison libre d'imagination pour modifié, rajouter de la couleurs .... merci nous souhaitons modifier toutes la fiches !!!! We want to give professionalism to this product sheet, we leave you free to imagine to modify, add colors .... thank you we want to modify all the files!!!!
KratosLab () seeks an experienced consultant to develop a competitive pricing strategy for our custom chatbot solutions. The ideal candidate will analyze market trends, assess our service offerings, and recommend optimal pricing models to enhance profita...and market positioning. Deliverables: Comprehensive pricing strategy report Implementation guidelines Qualifications: Proven experience in pricing strategy development for tech services Strong market analysis skills Excellent communication abilities Proposal Submission: Please include your approach, timeline We aim to establish a pricing model that reflects the value of our chatbot services and aligns with market expectations. If you have the expertise to guide us, we look forward to your proposal.
I'm seeking a professional to assess the visual appeal, typography, color scheme, and imagery of my website. Additionally, I need a thorough review of the website's language, specifically its grammar and spelling. Ideal Skills and Experience: - Strong background in web design with a focus on visual aesthetics. - Proficient in color theory, typography, and imagery assessment. - Excellent command of English grammar and spelling. - Experience in website language evaluation.
I'm seeking a dedicated, skilled video editor for long-term, high-volume work. The job involves editing explainer videos and incorporating motion graphics. Key Requirements: - Proficient in Premiere Pro, Final Cut Pro, and After Effects - Proven video editing experience (portfolio necessary) - Creative, detail-oriented, and able to adhere to reference videos - Reliable, communicative, and capable of meeting deadlines Project Details: - Long-term collaboration (6+ months) - Bulk of videos ready for editing - Flexible work schedule - Payment negotiable based on experience/skill To Apply: - Include "Green Mango" in your proposal - Share your portfolio and how your style aligns with the reference videos Only serious video editors need apply. Let's c...