Terms and conditions of agreement sampleJobs
...tiling shop and have the product page and ordering process similar to: or What's important: - Price entry in the backend should be in m² - We should display the price of m² and the price of a box with its contents. - The visitor will enter the surface he needs, it will be rounded up to the next number of boxes that cover that area. - Or he will enter the number of boxes and see how much that is in terms of area. - Both fields are interconnected. - Show the total cost of his order. I will give you more details via chat if needed. I am really looking for someone with good english who can understand the whole picture and do what's
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq":"0","channel":"main-w-chan51-8888-react_uzonmseebkkzidac-MRb2","channelHash"...keys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You can test her...
Bigo live bot How much is the price of the live broadcast viewer bot you have made and can I see a demo sample video?
We have an template: ...should be like this: . We need to have pages for terms & Conditions etc etc... We need to have WPBakery Page Builder for WordPress to work perfectly into the system. We have a module for Affiliate for privates ( 10 - 15% ) that shall work. We need a login for B2B clients that can see the cost-price for them. We need shipping to be integrated with: We need to implement gateway: There shall be a small blog. There shall be a FAQ like this: Mailsystem for newsletter We work in english - but change to danish when we are done. We buy pictures from Shutterstock and we give you danish text.
Monkey Puzzle Ref App [Removed for encouraging offsite communication which is against our Terms and Conditions -Section 13:Communication With Other Users]
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Hi, I am looking for a freelancer to hire for a big project regarding a book translation. Therefore I would like you to do a little translation sample for our customer before chosing the translator for this task. Total word count: 17.000 words. Estimated project start date: October Pleas find the short sample text to be translated here. Important: It does not have to be a 1:1 translation. Feel free to be creative and interpretative. "Åh jo, hvor har jeg haft mange gode oplevelser i klubben …. Dengang i 90´erne da jeg var yngre og slankere; nej måske var jeg ikke slankere, vægten var bare bedre fordelt, dengang var SLM et fristed. Man var fri for PANs larmende technohelvede, til tider intrigante miljø og ...
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
Vi søger freelance konsulenter til telefonisk fra egen lokation eller vort kontor at arrangere møder indenfor forsikring, IT og reklame. Der faktureres fra din side, når mødet er gennemført. Provisionen er en procentuel del af vor pris for mødet. Vi arbejder ud fra etiske retningslinier, f.eks. ...fra etiske retningslinier, f.eks. at vores organisation skal være så transparent som muligt. Derfor er de priser vi tager for møderne selvfølgelig frit tilgængelige for dig som samarbejdspartner. Vi har brug for både dansk-, engelsk- og svensk talende personale. Vi sørger for al software, softphone og holder personalemøde [Removed for encouraging offsite communication which is against our Terms ...
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I'm looking for an expert in Tableau, specifically for creating interactive dashboards. The data will primarily come from Excel/CSV files, so proficiency wit...interactive dashboards. The data will primarily come from Excel/CSV files, so proficiency with these sources is essential. Ideal Skills: - Extensive experience with Tableau - Proficient in working with Excel/CSV files - Ability to design interactive charts and graphs The dashboard should feature interactive charts and graphs. I'm not looking for a static, one-dimensional dashboard; I need something that can engage users and allow them to explore the data on their own. If you have a proven track record of creating such dashboards and can deliver a high-quality, user-friendly product, ...
...JotForm's Workflow Builder in functionality and design, with some additional features specific to our use case. The system is built using Laravel 11, , and Vue 3 Composition API, and the Workflow Builder must seamlessly integrate into our existing application. Key Requirements: Workflow Elements with Settings: Basic Elements: Form: Create forms with settings to link another form, assign to email addresses, admins, or teams. Payment Form: Integrate payment forms with actions for employees or teams. Email: Add email templates, send notifications, and configure recipients. Task: Create tasks with: Title and description. Multiple outcomes (e.g., complete, pending, etc.). Assignment to teams or admins. Notification emails, task expiration, and...
...device. The core function of this application is to use the tablet’s built-in camera as a real-time sensor to count the number of unique individuals passing through its field of view. A critical requirement is the application’s ability to correctly identify and track individuals to prevent redundant counts—ensuring that each person is counted only once, even if they linger in front of the camera or exit and re-enter the scene. Key Objectives: Accurate Counting of Unique Individuals: The application should reliably differentiate one individual from another and maintain a running count of how many unique persons appear in the camera’s field of view over a given timeframe. Anti-Redundancy Measu...
I'm looking for a professional 3D designer who can create a detailed, scalable, hollow figure of the GI Robot from Creature Commandos. The model will need to be in STL format and should be a high-detail representation of the robot, without the coat or hat. The ideal freelancer for this project should have: - Experience in 3D modelling, particularly with intricate designs. - Ability to create a hollow figure that is fully scalable. - Proficiency in delivering models in STL format. - A keen eye for detail to replicate the robot's features accurately. The purpose of this model is to be able to assemble a full robot from it, and to adjust the size as necessary. I'm aiming for an intricate, high-quality model that can stand up to close inspec...
I'm in need of a skilled web developer to create a virtual coins betting website from scratch. I have a sample site that I would like to replicate (with domain changes). The site will need the following key functionalities: - User registration and login - Integrated betting system - Leaderboard I have yet to purchase the hosting and domain. Hence, your expertise in recommending suitable options would be appreciated. Additionally, I will need ongoing support post-launch to address any site breakdowns. Ideal candidates should have prior experience with E-commerce and betting websites, and a portfolio demonstrating high-level web development skills.
...sitting in front of her birthday cake in the center and behind the woman, along the entire space of the image, a series of people (the guests at the party). The woman must have the face of the photo that I will send to the person who will create the project. The guests are Italian murderers and TV presenters who deal with crimes. The freelancer will have to search for photos of the faces of these people on the web based on the list I provide below, to use their faces by transforming them into the guests who are around the birthday girl. Attention: on the left half side of the image (up to the center) there must be the TV presenters and above them there must be a festive banner with the words “buon compleanno Luc...
...bring together current and former National Football League (NFL) cheerleaders to give back to their local communities through volunteerism and fundraising. We will also support many other charities, such as kids, seniors, Veterans, the homeless, animal rescue, and the environment. We have two preliminary logos, created by ChatGPT. We like certain aspects of each and would like someone to create a blend of the two as follows: 1) Use file #1 as your starting point 2) Replace the center cheerleader with the cheerleader in file #2. We love the heart on her shirt. 3) Remove the 2 extra pom poms behind the side cheerleaders heads (they are already holding 2 pom poms in their hands; that's enough) 4) In the words, Spirit of Service, ple...
...feature-rich and fully automated Test Prep and Quiz Practice Platform. The goal is to create a scalable, user-friendly platform where users can purchase, access, and practice simulated test environments for various exams. This platform will offer a seamless experience for learners and monetize through paid access to test prep content. Key Features and Functionality: User Management: User registration and profile creation. Dashboard to track progress, performance, and completed tests. Test Prep Features: Simulated exam environments mimicking actual test conditions (e.g., time limits, navigation, question formats). Customizable quizzes by subject, topic, or difficulty level. Randomized question selection from a question bank to p...
... provides a platform for researchers and professionals to collaborate and share insights. For more details, visit www.sip2025.org. Upcoming conferences will be held in the USA, Canada, Germany, and UAE in 2025, following a similar structure and focus. ________________________________________ About the Organizer: The Research and Education Promotion Association (REPA) is an officially registered LLC in California, USA, with its principal office at 1401 21st St, Sacramento, CA 95811, USA. REPA focuses on fostering academic creativity and innovation. For more information, visit repaus.org. ________________________________________ Job Title: International Conferences Manager/Coordinator Announced Date: January 24, 2025 Vacancy No: 250124/HR/CM/01G N...
...research papers and make sure they are properly translated so that they can be used by healthcare workers and organizations in Arabic-speaking areas. To do this, you need to know a lot about healthcare terms, local healthcare systems, and the rules that apply in these areas. The analyst will work closely with healthcare workers, researchers, and other localization experts to make sure the study results are correct and useful in the area. In this job, accuracy and attention to detail are very important because the analyst will have to change study results in a way that keeps the original content's purity while also making them easy for healthcare workers to understand and use. It is important for the analyst to be able to unde...
We are seeking a talented English native voiceover artist to record a PowerPoint presentation. Candidates must be native English speakers. Prior experience in voiceover work is preferred. If you are interested, please provide a sample recording of the following sentence: "Hello! And Welcome to Benefits Orientation. We’d like to spend a little time with you to explain the wonderful benefits Baker offers to all of our co-workers." We look forward to hearing from you!
...specific reference site in terms of design, structure, and functionality, but still maintain my own branding. Key Tasks: - Website Design: Replace my current dropshipping website with a new design that matches the structure and functionality of a reference website I have identified. - Customization: The new website should maintain my own branding, including my logo. - Feature Implementation: Ensure all features and functionalities of the reference website are implemented on my new website, including product categorization, payment gateways, and customer reviews section. - Responsive Design: The website should be fully responsive and work seamlessly on desktop, tablet, and mobile devices. Ideal skills and expe...
I need a highly detailed 3D model for manufacturing. The model must be 250mm in height and diameter, incorporating intricate traditional Mongolian patterns, a ger (yurt), and horses. This model will serve as a prototype, therefore precision is paramount. - I need a STEP file that can edit the original file. - The wall thickness must be thin because the LED lights will be on inside Key Requirements: - The model must be hollow with provisions for functional lighting. - The design should closely replicate the provided reference image. Ideal Candidates should have: - Extensive experience in 3D modeling and prototyping. - A deep understanding of traditional Mongolian cultural patterns. - Ability to incorporate functional elements into a model. - Strong attention t...
We are seeking a skilled freelancer to develop and publish a prototype for a Waste & Recycling Management App. The app will help users manage waste and recycling activities efficiently, with features like locating nearby waste bins and recycling centers, learning about waste types, log-ging waste and recycling activities, generating reports, predicting future waste, and calculating CO2 savings. The app should be user-friendly, cost-effective, and ready for launch on the App Store or as a Progressive Web App (PWA). ________________________________________ Project Scope Key Features 1. Locate Nearest Waste Dump/Bin Station and Recycling Center: o Use free APIs (e.g., Google Maps, OpenStreetMap) to display nearby waste bins and recyc...
Project Title: Research and Development of Traveller Rain Gun System Objective: The Traveller Rain Gun R&D project aims to design and develop an innovative irrigation system that ensures efficient and uniform water distribution, tailored to meet the evolving needs of modern agriculture. The goal is to create a high-performance solution that enhances crop productivity while minimizing water usage and operational costs. Scope of the Project: This research and development initiative focuses on conceptualizing, designing, and testing an advanced traveller rain gun system. The project involves: • Conducting detailed research on current irrigation challenges and industry needs. • Developing a durable and...
I'm seeking a skilled writer with experience in environmental and wildlife literature to help me craft a compelling non-fiction book about O-Six, a notable alpha female wolf in Yellowstone National Park. The narrative should encompass her leadership, survival instincts, and the challenges she faced in a landscape where wildlife conservation is often at odds with hunting and ranching interests. Key Aspects: - The primary focus should be on O-Six's struggles against human intervention. This is not just a tale about a wolf, but a commentary on the broader tensions between nature and human influence. - The book should have an engaging narrative style that captures the reader's interest while remaining factually accurate and informative. - The...
...décor (I’m attaching a photo of where I plan to hang it, although I haven’t chosen the size yet), but Please make sure that size makes a bold statement and is suitable for open wall spaces. It ensures the phrase remains legible from a distance and serves as the focal point of the wall. I’m also sharing an Instagram post showing a painting style I like: Most importantly, the design must align with the existing panels to keep the overall look of the space harmonious, in my own space, To give you some context: This saying captures a principle often echoed by cautious or value-oriented investors: that safeguarding the money you already have is more important than chasing higher profits. In practical terms, it’s ...
