Sample bill of materials for house constructionJobs
The specs for this project are Wordpress based / Editable in the backend of the site Fast in google page speed insights Goal is under 2 seconds on all pages WP rocket + CACHING + MINIMISE PICTURES Features Videos Picture slides Animation videos Editable text Editable pictures Editable blocks Editable logos Create unique URLS - SEO wise Design wishes 14 different logos containing the name of each “BRAND name” FIGMA only / UX optimizing just like on FIGMA project Requirements WORDPRESS BASED Able to connect up with our DIV - contact formular on - FROM OUR BACKEND DEVELOPER (RoR Ruby On Rails) It should always be possible to load external JS as the current one is based on, so I don't think they can make something that won't work with the type ...
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq"...com","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersion":{"LIUS:d1a97be745ad05203c316c52e05659bc":0,"LIUB:51c686f136238887af1ffc4ce43bb59d":0}}}"; Make sure whatever you extract is valid JSON (move end point of extract around so JSON is valid). You ca...
We have two documents with URL's that needs to be scraped. The scripts is partly made, but have some flaws. Script 1 : We need to be able to scrape URL's like these: What we need of info is : * Name of restaurant * Adress * Postalnumber + city * URL So the data retrieved should be delivered in a csv file : "Den Gamle Grillbar og BBQ", "Holsteinsgade 12", "8300 Odder", " " "Marios Pizza", "Melstedvej 17", "2770 Kastrup", "" "Tobclas Sandwich", "Torvet 3", "8700 Horsens" ,""
I need a complete material list from drawings. The project is Ib polish.
Bigo live bot How much is the price of the live broadcast viewer bot you have made and can I see a demo sample video?
...this, then the job is not for you. I would like to encourage females to place a bid. Skills count for more than gender in the end, though. But women ROCK! ;) I will need something visual and/or clickable since I do not speak "tech" at all. It's like reading Mandarin or Swahili to me. Must work in the WP theme Astra. I can't provide link just yet to the Astra theme, since the developer is unavailable for a few days. We can buy the PRO version if needed. Go to The site is in danish, but the functions will be more or less the same. The job is ONLY for the price calculator with the green slider input, some variables as add-on choices with a preset default value, and the price with an output. We need a slightly simpler version of...
I have a 2400 sqy agriculture land looking for ideas to build a farm house
The creation of a virtual office
Hej Eyedea House Inc., jeg har lagt mærke til din profil og vil gerne tilbyde dig mit projekt. Vi kan drøfte detaljerne i chatten.
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
...grunden, men på kundens tekniske .Net rammeværk/fundament. Primære kompetence: Da vi har mange snitflader har vi behov for en udadvendt og kommunikerende person der ikke har problemer med at holde en del bolde i luften på samme tid. Konsulenten skal også være selvkørende og gerne have arbejdet agilt før. Faglige kvalifikationer: Skal være 100 meter mester i Angular4, men også meget gerne have forståelse for/udviklet lidt i .Net Erfaring: Meget gerne med lignende opgaver hen over de sidste par år. Varighed: 9 måneder, fuld tid. I alt 155 timer pr. måned. Freelanceren vil arbejde på kundens adresse i Østerbro, København. Description of tasks...
... I am looking for a freelancer to hire for a big project regarding a book translation. Therefore I would like you to do a little translation sample for our customer before chosing the translator for this task. Total word count: 17.000 words. Estimated project start date: October Pleas find the short sample text to be translated here. Important: It does not have to be a 1:1 translation. Feel free to be creative and interpretative. "Åh jo, hvor har jeg haft mange gode oplevelser i klubben …. Dengang i 90´erne da jeg var yngre og slankere; nej måske var jeg ikke slankere, vægten var bare bedre fordelt, dengang var SLM et fristed. Man var fri for PANs larmende technohelvede, til tider...
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg sk...lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel De...
pemasangan bumbung dan atapzeng dan wellding mig
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
...been done. Only off-page SEO optimization is required to improve keyword ranking on Google. For anyone interested in this project, please submit a detailed proposal of how the keywords will be ranked and the techniques used. Full report of the work done must be submitted. All work has to be done manually using white-hat processes. -- Only white hat, experienced, highly ranked on freelancer.com SEO experts should bid -- Quality back links must relate to site topic on high quality relevant sites -- No black hat, gray hat or unethical SEO methods are to be used -- no junk profile building techniques are to be used -- No use of automated software or bots -- No links from under construction pages -- No java links, jump scripts, framed pag...
Rengøring af 190 m2, hver anden uge. Gulvvask, støvsugning, toiletter og vandrette flader.
poster for online posts 3 pictures Bold
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
ACLS is privately owned construction and logistic company with its offices in United States, Arab Emirates and Afghanistan. The Company has been responsible for the design and construction of some of the most significant projects in Afghanistan. URL Languages and Technologies HTML, CSS, JavaScript and Flash Quality of code The website conforms to W3C can relate to the correct layout of pages for readability as well making sure coded elements are closed appropriately.
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I'm looking for a freelancer based in either South or North America. Your role will primarily be to provide me with some needed resources or support. Ideal skills for this job include: - Good communication skills - Understanding of basic task execution - Ability to source relevant materials or support Please note, this is not a writing, design, or programming task. It’s about being a provider.
I'm in need of a skilled mechanical engineer with a strong background in materials science, specifically focusing on understanding and solving problems related to the mechanical properties of various materials commonly used in construction.
...graphic designer to create 5 title pages for a presentation/course. The domains are listed below. Each page needs to maintain a professional and formal style, incorporate our company branding colors, and use our standard fonts. Domains: 1. Security Operations & Leadership 2. Defensive Tactics & Use of Force 3. Verbal Judo & Tactical Communication 4. Security First Aid for the Field 5. Emergency Management & Response Specific requirements: - Each title page should feature the Security Responder logo. - Each page should include the text "Domain" followed by the respective number. - Each page should include a corresponding picture (to be provided). Ideal skills for this job include graphic design, brand adherence, and a strong ...
I'm in need of a designer who can help me finish a half-done, minimalistic logo. The primary purpose of this logo is for brand recognition, product packaging and marketing materials. It needs to be monochrome as per the current design. Ideal Skills and Experience: - Strong graphic design skills - Experience with minimalistic design - Understanding of brand-oriented design - Ability to work with monochrome color palette - Proficient in design software like Adobe Illustrator or similar
I'm seeking a professional designer to create a sleek, modern and minimalist 2-page restaurant menu. The menu should include: - Page 1: Appetizers and mai...designer to create a sleek, modern and minimalist 2-page restaurant menu. The menu should include: - Page 1: Appetizers and mains - Page 2: Drinks and desserts, Specials and promotions - one spot for remarks notes and or to say something - one spot for a picture if we want - sample of what we would like is provided along with our logo - we will need to be able to change the menu - items and rates etc... on our own in future - we require 3 draft / edits The ideal candidate should have a strong portfolio of modern minimalist design and experience in creating restaurant menus. Please provide...
