Risks of ai in healthcareJobs
...titler, beskrivelser, og billeder, direkte ind i vores online shop. Dette projekt kræver en særlig tilgang, hvor produktinformation genereres ud fra billeder ved hjælp af en AI-generator (tilvejebragt gennem en API vi stiller til rådighed), med fokus på følgende nøgleelementer: Automatisk Titel og Beskrivelsesgenerering: For hvert produkt, et billede uploades, hvorfra AI-generatoren (ChatGPT eller tilsvarende) skal udlede en produkttitel og en detaljeret beskrivelse. Billedet vil indeholde et produktnummer, som er essentielt for vores produktkatalogisering. Målet er at automatisere denne proces, så manuel upload til AI-generatoren minimeres eller elimineres. Produktoprettelse med Variabler: Produkterne skal ...
I must have made a chat robot that can answer chats in a chat program automatically, it must be able to keep a conversation running via chat gpt or similar AI, it must be able to speak both Danish, English and Norwegian. It must be able to answer the texts itself in the window where the text is to be written I has to be able to read previous chats and answers on the website
Hello! I am looking for a talented designer to create a banner for me. This banner needs to be 33.5" x 80" and will be used to promote a specific event. The designer for the banner should use Adobe Photoshop and keep in mind a specific color scheme that I have in mind. The final file should be provided as a 300 DPI. The ideal designer for this project should have experience cutting large and intricate banner design. If you believe you are up to the task, please apply to the project. Thank you and I look forward to discussing the project with interested applicants. The logo AI and colors will be sent Reference:
If you have evanto elements subscription and willing to share it , please DM me
Vær venlig at Tilmelde dig eller Log ind for at se detaljer.
In the attached HTML pages extract the (valid JSON) part only (Python or PHP). Starts with : {"data":{"question":{"pagedListDataConnection" Ends somewhere here : {"minSeq":"0","channel":"main-w-chan51-8888-react_uzonmseebkkzidac-MRb2","channelHash":"17978758530268586595","boxName":"chan51-8888","baseHost":"","targetUrl":"","enableWebsocket":true},"broadcastData":{"categoryToDepkeys":{"Viewer:isUniversalLoggedIn:Vmlld2VyQDA6MA==":["LIUS:d1a97be745ad05203c316c52e05659bc","LIUB:51c686f136238887af1ffc4ce43bb59d"]},"depkeyToVersio...
The creation of a virtual office
Lav logo fra PNG til AI fil med outline.
2 A4 size pages (4 sides) brochure of a healthcare consultancy
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
01- CAN NOT USE google API 02 - Need code for android ''navigation'' & coordinate locator on OWN MAP 03 - OWN MAP is a small area of 20 km x 10 km - have in AI format
Design A Catalog Of Products (1 Page)
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' Insert QR codes into large AI vector graphics file'
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
...to develop an AI agent capable of generating articles and blog posts, and integrating MyMind functionalities into ChatGPT or a similar platform. Key aspects of the project include: - The AI agent should focus on creating articles and blog posts. - The integration should allow for organizing ideas and notes, as well as facilitating brainstorming and creative thinking. - The AI should be able to gather information for content creation predominantly from user input. Ideal Skills and Experience: - Proficiency in AI and content generation systems. - Experience with MyMind and ChatGPT or similar platforms. - Strong understanding of web scraping and database management. - Excellent programming skills, preferably in Python or Jav...
...rule, so it must be a priority. 2. Key Requirements Advanced AI – the program must play at a high level and be hard to defeat. The "if you miss a capture, you lose a piece" rule – most important! Capturing is mandatory, but if the player does not capture when possible, they lose the piece – the program does not force the capture but simply removes the piece if the player fails to make the move. Capturing can be both forward and backward. A king (damka) moves across the entire diagonal and can capture in any direction by jumping over opponent's pieces. No need for a two-player mode, only a game against AI is required. 3. Explanation of the "if you miss a capture, you lose a piece" rule This is the most impor...
I need a professional g...materials, ensuring it maintains its quality at any scale. I am sharing visuals and i will give more detailed information also. Deliverables: - The final vector file in formats such as .ai, .eps, or .svg - An exact color match to the original logo - Deliver the final vector file also in PDF format suitable for sharing with clients or printers. Requirements: - Proven experience in vector design (please provide examples of previous work) - Ability to accurately recreate logos in vector format - Attention to detail and a strong understanding of color and design principles - Timely delivery and clear communication Please include in your proposal an estimated timeline for completion and your price. If you requi...
...looking for a skilled AI video creator to generate a realistic-style video using AI. The content will depict fictional interactions between well-known people, similar in style to Unknown Collective. The video is for a hip-hop song, so the appearance must be engaging and stylish. The video will accompany a 4-minute song, but a loopable 1-minute 20-second sequence is sufficient. What I Will Provide: 3 to 4 scene concepts with clear descriptions of the interactions. We can talk about this more in depth, to evaluate viability. Reference images or examples for character likeness and atmosphere. Requirements: Experience in AI-generated video tools. Ability to create high-quality, realistic depictions of famous personalities. Smooth ...
AI Voice AgentsNever miss a call again! Our AI voice agents handle your phone lines 24/7, speaking naturally with customers and handling routine tasks automatically. We build and train them specifically for your It Does:Brightdock AI Voice creates your perfect AI phone team that:- Answers calls instantly in a natural, friendly voice- Handles bookings, questions, and common requests- Works alongside your staff, sending them only the complex issues- Speaks multiple languages if you need it- Connects smoothly with your current phone systemHow It Helps You:Real examples of how businesses use it:- Medical offices have appointments booked automatically while staff focus on patients- Service companies handle after-hours emergency calls without expensive ...
As discussed on chat and per the previous listing you applied for with an adjusted price of half given that the project is 1/10 the original size. Previous listing is closed so no adjustment on the bid is possible.
I need a skilled engineer to assist with the implementation of a unique AI technology stack. The project primarily revolves around working with a mostly automatically-generated platform OS that utilizes simpler AGIs and SAI. While the job may seem complex, it will primarily involve working with the programs’ binary and the AI of the generated OS. The ideal candidate will have a strong background in artificial intelligence, particularly in simpler AGIs and SAI, and will be comfortable working with binary code. Experience with AI in OS development is a plus.
I'm looking to have my bank statements for the year summarized. The statements are in PDF format. there are 2 accounts,. need a year end summary for each account for tax purposes. income and expense with sub categories per account year end. and a reconstitued balance sheet , statement fo cash flows, and income statement using only these statements, Requirements: - The summary should categorize transactions and provide monthly totals. - All transactions should be included, not just credit or debit transactions. Ideal Skills: - Proficiency in data analysis and financial summarization. - Experience with PDF data extraction and AI tools. - Attention to detail.
I'm in need of a vibrant, eye-catching, and user-friendly WordPress website for my software development company. I will provide the company name, address, contact and logo. Key Requirements: - Design options: Please present me with several design alternatives that embody a 'Creative and Colorful' style. - Pages: The website should encompass the following sections: Home, About Us, Services (multi page) and Contact Us. - Performance: The site needs to not only look attractive but also run seamlessly. Ideal Skills: - Proven experience with WordPress and web design, particularly in creating dynamic, colorful sites. - A strong portfolio demonstrating creative and colorful designs. - Excellent understanding of user-friendly design principles. I lo...
...focus on AI-related content and venture capital. The primary objective is to position our venture studio as a thought leader in AI and venture investing by creating, curating, and promoting high-quality content, including blog posts, industry insights, and startup ecosystem trends. Key Responsibilities: • Develop and execute a strategic social media plan focused on increasing brand awareness and engagement. • Write and publish compelling, technically accurate AI-related and venture capital-focused posts, ensuring clarity and consistency. • Curate and promote blog posts, research insights, and investment trends across LinkedIn and Twitter/X. • Monitor, analyze, and report on key social media performance metrics, making data-driven recommen...
Hello, I'm looking for a logo to be designed. The company name is Monotrac Articulation. We sell products to the dental laboratory industry. We are looking for a modern logo that looks great on the web and printed materials. I've included a low-quality image of logo that AI happened to create as part of a flyer that I asked it to produce and I thought it was attractive. Don't feel like you are limited to this, however, I'm hoping to see a variety.
Using **Zapier + OpenAI API** is a great way to integrate an AI assistant into your website **without coding**. Zapier allows you to automate workflows by connecting OpenAI’s API with various platforms, including your website, email, and chat systems. ### **Steps to Use Zapier + OpenAI API for No-Code Automation:** #### **1. Set Up Your OpenAI API Key** - Sign up at [OpenAI](). - Go to **API Keys** in OpenAI and generate a new key. - Copy and save the API key somewhere safe. #### **2. Create a Zapier Account & Start a New Zap** - Sign up at [Zapier](). - Click **"Create a Zap"** (Zaps are automated workflows). - Select a **Trigger** (e.g., new form submission, chat message, email received). #### **3. Choose a Trigger
Development of a coming soon landing page 125 USD.
I'm in need of a comprehensive, web-based hospital management software. This software should cater to the following aspects: - Patient Records Management: The ability to efficiently handle and track patient data. - Scheduling and Appointments: A system for managing hospital schedules and patient appointments. - Billing and Invoicing: An integrated system for hospital billing and invoicing. Crucially, the software must support varied access levels for different user roles, specifically: - Administrator - Doctor - Nurse - Receptionist Ideal candidates for this project should have extensive experience in software development, particularly in the healthcare sector, and a strong understanding of the requirements for different hospital roles. E...
