List of soil tests for road constructionJobs
The specs for this project are Wordpress based / Editable in the backend of the site Fast in google page speed insights Goal is under 2 seconds on all pages WP rocket + CACHING + MINIMISE PICTURES Features Videos Picture slides Animation videos Editable text Editable pictures Editable blocks Editable logos Create unique URLS - SEO wise Design wishes 14 different logos containing the name of each “BRAND name” FIGMA only / UX optimizing just like on FIGMA project Requirements WORDPRESS BASED Able to connect up with our DIV - contact formular on - FROM OUR BACKEND DEVELOPER (RoR Ruby On Rails) It should always be possible to load external JS as the current one is based on, so I don't think they can make something that won't work with the type ...
Hej. Vi er ved at udvikle en webapplikation. Frontend er lavet med Quasar framework og VueJS . Backend er lavet med NestJS og NodeJS. Vi benytter Jira Cloud og Bitbucket fra Atlassian. Vi er så småt gået i gang med at opsætte Bitbucket Pipelines således at vi opnår: 1. På commit i Bitbucket, byg af backend- og frontend-kode samt automatisk kørsels af tests 2. Opsætning af miljøer i Azure (vi forstiller os Dev, Test, Staging og Prod miljøer) 3. Automatisk deployment til Azure Dev miljø, ved commit på Dev branch. 4. Automatisk deployment til Azure Test miljø, ved commit på Test branch. 5. Manuel deployment til Azure Staging/Prod miljø 6. Overblik ("release notes") af æ...
I need a complete material list from drawings. The project is Ib polish.
...this, then the job is not for you. I would like to encourage females to place a bid. Skills count for more than gender in the end, though. But women ROCK! ;) I will need something visual and/or clickable since I do not speak "tech" at all. It's like reading Mandarin or Swahili to me. Must work in the WP theme Astra. I can't provide link just yet to the Astra theme, since the developer is unavailable for a few days. We can buy the PRO version if needed. Go to The site is in danish, but the functions will be more or less the same. The job is ONLY for the price calculator with the green slider input, some variables as add-on choices with a preset default value, and the price with an output. We need a slightly simpler version of...
The creation of a virtual office
...opslag op, hvor emnet er "Juniorsenge". Artiklen skal være ca. 2000 ord (byd på en pris for 2000 ord) og vil fungere som en test for at se hinanden an. Jeg håber jeg kan finde en skribent, der kan skrive for os fremover. Detaljer: Emne: Juniorsenge Stil: Forbrugeroplysning Research: Begrænset, du vil få leveret links til kilder Sprog: Dansk Længde: 2000-3000 ord. Om dig: Du har interesse for børn og børneliv, det er et klart plus hvis du selv har børn og kan bidrage med din egen vinkel fra egen erfaring. Du må meget gerne i forvejen skrive om emnet, fx som blogger. Du kan i så fald få link og promovering af din blog i din forfatterbio. I tillæg er det et STORT plus...
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg sk...lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel De...
I have my campaign
Har brug for hjælp til en statistikopgave inden for de her emner: Beskrivende statistik * Udvælgelse af stikprøver - simpel tilfældig * Central tendens, variation, skævhed og ekstremer Diskrete og kontinuerte fordelinger * Herunder Binomial-, Poisson- og Normalfordelingen * Varians og kovarians af et sæt stokastiske variable herunder linearkombinationer vhj. af matrixalgebra. Konfidensintervaller og hypotesetest vedrørerende * Middelværdi og varians Analyse af krydstabeller og goodness-of-fit tests Ensidig variansanalyse Simple og multiple metoder i regression Anvendelse af statistisk programmel til analyse af et datamateriale
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
...been done. Only off-page SEO optimization is required to improve keyword ranking on Google. For anyone interested in this project, please submit a detailed proposal of how the keywords will be ranked and the techniques used. Full report of the work done must be submitted. All work has to be done manually using white-hat processes. -- Only white hat, experienced, highly ranked on freelancer.com SEO experts should bid -- Quality back links must relate to site topic on high quality relevant sites -- No black hat, gray hat or unethical SEO methods are to be used -- no junk profile building techniques are to be used -- No use of automated software or bots -- No links from under construction pages -- No java links, jump scripts, framed pag...
Keyword list: 1. Hydrocortisone Spray for Dogs 2. Dog Heartworm Medicine 3. Dog Barrier for SUV 4. Tapeworm Medicine for Dogs 5. Belly Bands for Male Dogs 6. Dog Water Bowl No Spill 7. Dog Car Ramps 8. Hot Spot Treatment for Dogs 9. Automatic Dog Waterer 10. Dog Poop Scoopers Same spreadsheet, same steps
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
ACLS is privately owned construction and logistic company with its offices in United States, Arab Emirates and Afghanistan. The Company has been responsible for the design and construction of some of the most significant projects in Afghanistan. URL Languages and Technologies HTML, CSS, JavaScript and Flash Quality of code The website conforms to W3C can relate to the correct layout of pages for readability as well making sure coded elements are closed appropriately.
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I'm seeking a skilled NextJS specialist to assist with upgrading my PayloadCMS project from version 2.0 to 3.0. The ideal candidate will have a strong understanding of PayloadCMS functionalities, with the following core responsibilities: - Evaluating the current setup - Implementing the upgrade - Ensuring compatibility with existing features It is crucial that the following functionalities remain intact after the upgrade: - Content Management - API Integrations My current setup does not include any custom plugins or modules; I'm using only the default features of PayloadCMS. However, I do have some partial automated tests in place to verify functionalities post-upgrade. If you're passionate about enhancing web applications and have a strong backgrou...
Here’s the updated job description reflecting your changes: --- ### **Job Description: Freelancer for Global Company Mapping** **Project Title:** Mapping Major Global Companies **Objective:** We aim to create a detailed directory of: - Major construction companies, boat builders, and cruise/touring boat manufacturers. - Companies with over 5,000 employees and at least 4 subsidiaries. The project involves mapping key subsidiaries in Europe, Asia, and South America, along with their organizational structures and direct contact details. Contacts will be delivered progressively to ensure quality control and integration into our catalog. **Responsibilities:** 1. **Data Collection:** - Use tools like Lusha, , and any additional necessary pl...
I'm looking for a professional to assist with the Tombia Roundabout project. This professional should have extensive experience in road construction and management. The goal is to enhance the functionality and safety of this roundabout. Ideal Skills: - Road construction expertise - Project management - Safety assessment Key Responsibilities: - Propose, design, and oversee the construction of necessary improvements.
i want someone to evevate the css of my page and check mobile view also i want to set correct seo for all page. Mostly i want someone profesional in css
I'm looking for a professional 3D designer who can help me visualize my restaurant model. The focus is primarily on the dining area. Key Requirements: - A detailed, high-quality 3D diagram of the dining area, incorporating my vision of a specific style or theme. - A comprehensive high-detail layout of the kitchen and workflow area, including fixtures, furniture, and decor. - Ability to interpret and translate my ideas into a visual format. Ideal Skills: - Proficiency in 3D design software. - Experience in designing restaurant layouts. - Strong communication skills for understanding and implementing my vision.
as agreed in the previous chat
...and safe transport of trusses and columns. Main requirements: 1. Construction function: o The structure must ensure stable storage and safe transport of parts such as trusses and columns. 2. Modular design: o After removing the elements from the structure, it will be disassembled and transported by bus back to the company. o The structure must be easy to assemble and disassemble, composed of modules that can be quickly packed and transported. 3. Maximum dimensions: o Width: 2.2 m o Height: 2.5 m 4. Transported parts: o Trusses – we produce 4 types of trusses with a standard structure (drawings in the attachment). o Columns (sample drawings in the attachment): - Length: from 800 mm to 4500 mm. - Sections: 80x80 mm, 100x100 mm, 120x120 mm. 5. St...
I'm looking for a skilled web developer to create a simple yet effective website for my residential construction company. The primary purpose of the site is to generate leads. Key Requirements: - A design that showcases our projects and company information, yet primarily focuses on attracting potential clients in the residential construction sector. - A lead collection system that captures contact details from interested visitors. - Simple, user-friendly interface with easy navigation. Ideal Skills & Experience: - Proven experience in web development, especially for construction or similar industry. - Proficient in creating lead generation systems. - Strong understanding of designing user-friendly interfaces. - Portfolio s...
I'm looking for a professional to add a new webpage to my existing WordPress site. The content is readily available, and the goal of this new page is to generate leads. Key Requirements: - The new webpage should adhere to a modern and minimalist design style. - It needs to be both PC and Mobile friendly. - SEO friendliness is a must to enhance visibility on search engines. Additionally, I need the following functionalities integrated into the webpage: - My email and WhatsApp contact information on each page or at the end of each product. Ideal candidates for this project should have: - Proven experience in WordPress web development. - Strong understanding of modern and minimalist design principles. - SEO expertise. - Ability to integrate interac...
I'm in need of a straightforward, user-friendly website for my construction company. Its primary goal is to facilitate lead capturing and communication with potential clients. Key Features: - A call us now button so customers can reach us directly - A simple contact form on the contact page, to streamline inquiries and requests for quotes. - An 'About Us' section, providing visitors with insight into our company's mission, vision and team. - A 'Services Offered' section, detailing the range of construction services we provide. Ideal Skills: - Proven experience in web development, particularly for service-oriented businesses. - Strong understanding of lead capture mechanisms and user-friendly design. -...
...capable of passing NLP and AI detectors. Our current content has been flagged and removed, negatively impacting our SEO and causing penalties on Google. We need a solution to ensure our blog posts are crawled effectively by Google. **Responsibilities:** - Develop a content generation model using advanced NLP techniques, such as OpenAI's GPT. - Fine-tune the model with niche-specific content to enhance relevancy and originality. - Implement tools like and Grammarly for content validation before posting. - Ensure that all generated content passes AI detection tests to maintain our site’s SEO integrity. **Requirements:** - Proven experience in AI content generation and SEO best practices. - Familiarity with NLP models and their applications in blogging....
...to compile a comprehensive database of recently registered domain names along with relevant ownership or business details for the purpose of targeted outreach and lead generation for website development services. Database Scope: Collect domain registration data with a focus on recently registered domains (last 6-12 months preferred). Include data points such as: Domain Name Date of Registration Registrar Name Business/Registrant Name (if available) Contact Email or Phone (if publicly available) Country/Location Expiry Date (if accessible) Data Collection Methods: Utilize legitimate sources such as WHOIS databases, expired domain lists, and domain auction sites. No data collection that violates GDPR, CCPA, or similar data protection laws. Preferenc...
Dear Valued Client, I trust that you are well today. I'm writing to you regarding our sincere gratitude of the article of German Consumer Law description on publication. We are happy for trusting us as your valuable asset in legal article publication on anwalt.de. We're really appreciate your kindness, support, and good cooperation and looking forward to participate the next projects. Sincerely, Grace Ayu M
...looking for an engaging, 2-3 minutes augmented and virtual reality safety training video for tipper truck and other heavy vehicle drivers. This video should educate drivers on daily safety requirements, from the start of the day until the vehicle is parked. It should cover critical aspects like ensuring parking brakes are on, chocks are placed under the wheel, and more. Key Features: - The video should include narrations and have options for multiple language subtitles. The narration should be in selected language from multiple options, specifically Hindi, Arabic, and Urdu. - The video should demonstrate specific scenarios such as Pre-trip inspections, End-of-day procedures, tarping/untarping safety (working at height on top of truck), reversin...
I'm seeking a freelancer who can gather detailed pricing information on all ...Australia, including DoorDash, Uber Eats, Menulog, and others. This data should cover charges applicable to restaurants, drivers, and customers. The purpose of this project is multi-faceted; I aim to utilize this information for market research, personal insights, and strategic business planning. The ideal candidate for this role should have strong analytical skills, experience in market research, and a knack for data interpretation. Your findings will provide a comprehensive understanding of the pricing dynamics within this sector, targeting all key stakeholders - restaurants, drivers, and customers. This project is crucial for developing a well-informed perspe...
I am seeking an experienced developer to create a high accuracy algorithm for detecting REM sleep stages using EEG and EOG biosignals. The project is part of a smart wearable device focused on lucid dreaming, and the algorithm will play a critical role in identifying REM sleep stages and triggering real-time cues (light, sound, vibration) for users. Key Requirements Biosignal Processing: -Develop an algorithm capable of processing EEG and EOG signals to detect REM sleep with 95%+ accuracy. -Use dry electrodes and ensure the solution is compatible with wearable devices. Extraction: -Extract meaningful features like theta/beta wave activity and eye movement data. Model Development: -Train and fine tune machine learning models (Random Forest, SVM, or Deep Le...
