List of feeling words for counselingJobs
I need a complete material list from drawings. The project is Ib polish.
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
... I am looking for a freelancer to hire for a big project regarding a book translation. Therefore I would like you to do a little translation sample for our customer before chosing the translator for this task. Total word count: 17.000 words. Estimated project start date: October Pleas find the short sample text to be translated here. Important: It does not have to be a 1:1 translation. Feel free to be creative and interpretative. "Åh jo, hvor har jeg haft mange gode oplevelser i klubben …. Dengang i 90´erne da jeg var yngre og slankere; nej måske var jeg ikke slankere, vægten var bare bedre fordelt, dengang var SLM et fristed. Man var fri for PANs larmende technohelvede, til tider intrig...
I have my campaign
We already have a gallery in Aarhus Denmark and is in preparation for the opening of the dept . Number two in Hamburg .. There is in this project need Enthusiasts who can either sell through the Internet, Aarhus Dept. or open their own gallery in their city .. we would want such a scheme supporting the arts , counseling and support in all possible ways , we have the opportunity .. Ground Zero Organisation we are against your opening have certain criteria that must be met .. ----------------------------------------- Vi har allerede et Galleri i Aarhus Danmark og er i forberedelserne til åbningen af afd. nummer to i Hamborg.. Der er i dette projekt brug for Ildsjæle, som enten kan sælge via internettet, Aarhus afd eller åbne dere...
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
...livsstils-app "Way of Life - The Ultimate Habit Maker & Breaker" () til Android. Mange af de designmæssige spørgsmål er således afklaret og jeg skal derfor primært bruge en udvikler som hurtigt kan se hvordan den eksisterende app kan udvikles til Android. Hver platform har dog sine "måder" at gøre tingene på, så derfor må du også gerne have forstand på hvordan en måde at gøre tingene på i iOS, måske bør gøres anderledes på Android for at få den rigtig Android-feeling. De overordnede linjer er dog lagt. Way of Life gør flittig brug af SQLite (gennem Core Data) og det forventes at du mestrer enten SQLi...
Keyword list: 1. Hydrocortisone Spray for Dogs 2. Dog Heartworm Medicine 3. Dog Barrier for SUV 4. Tapeworm Medicine for Dogs 5. Belly Bands for Male Dogs 6. Dog Water Bowl No Spill 7. Dog Car Ramps 8. Hot Spot Treatment for Dogs 9. Automatic Dog Waterer 10. Dog Poop Scoopers Same spreadsheet, same steps
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
Looking to develop a dynamic educational website similar to , focused on providing practice tests for students. The website should allow kids to choose answers for multiple-choice questions and automatically display results similar to the functionality observed at Must be user-friendly, mobile-compatible, and equipped with a robust content management system to easily update and manage question sets. Key Features Needed: - User registration/login - Multiple choice question interface - Instant score display after test completion - Admin panel for managing questions and users - SEO optimized structure Required Skills: Web Development, PHP, HTML5, JavaScript, SEO
Looking to develop a dynamic educational website similar to , focused on providing practice tests for students. The website should allow kids to choose answers for multiple-choice questions and automatically display results similar to the functionality observed at Must be user-friendly, mobile-compatible, and equipped with a robust content management system to easily update and manage question sets. Key Features Needed: - User registration/login - Multiple choice question interface - Instant score display after test completion - Admin panel for managing questions and users - SEO optimized structure Required Skills: Web Development, PHP, HTML5, JavaScript, SEO
Peace, First of all, please don't come this project bidding with copypaste words. I search for coworkers whom I am willing to pay. I would like to share what I think via telegram, please write your adress on message. All I need is experience on php/node.js/django and ofcourse another person for front end so I need 2 coworkers. I need young people. So don't hesitate if you are not experienced. Edit:If you are better in french we can communicate in french too.
Scope of Work Translation of approximately 700 words from English to Polish. Maintaining clarity and formatting (English sentences clearly paired with Polish translation). Delivery of final document by 10 Jan 2025 Deliverables A Word (docx) or PDF file with English text alongside the Polish translation. Assurance that the text is localized appropriately for Polish readers (natural-sounding, no direct-literal translations). Minor adjustments for style and readability, if needed. Payment & Terms Total fee: 15 EUR Payment via Freelancer Escrow system to ensure both parties are protected. Please confirm via chat before I begin.
I'm looking for someone to find out for me what do Uber eats, Menulog or DoorDash In Australia give to all the restaurants in Australian as is a android hardware brands & models number as do have 5G SIM card & or WiFi. printer Built in Overall, I need comprehensive details on all types of hardware provided to restaurants by these services. This includes: - Detailed information about the Android hardware's SIM card capabilities. I want to know about all SIM card details, specifically focusing on 5G SIM cards - Complete specifications on the printer functionalities of these devices.
...strong understanding of brand marketing and social media strategies. Responsibilities: • Research: • Conduct market research on competitors and trends to inform campaigns. • Identify influencers for collaborations and compile outreach lists. • Graphic Design & Content Creation: • Design social media graphics, infographics, and promotional materials using Canva. • Create engaging content (when needed) for blogs, social media, and email campaigns. • Content Scheduling & Management: • Schedule posts on social media platforms like Instagram, Facebook, Twitter, and LinkedIn. • Organize content calendars and ensure timely execution of campaigns. • Appointments & Admin Support: • Request ...
Title: "Development of an Educational Website for Test Preparation" Description: "Looking to develop a dynamic educational website similar to , focused on providing practice tests for students. The website should allow kids to choose answers for multiple-choice questions and automatically display results similar to the functionality observed at Must be user-friendly, mobile-compatible, and equipped with a robust content management system to easily update and manage question sets. Key Features Needed: - User registration/login - Multiple choice question interface - Instant score display after test completion - Admin panel for managing questions and users - SEO optimized structure Required Skills: Web Development, PHP, HTML5, JavaScript
Cryptocurrency has become one of the most disruptive innovations of the 21st century, transforming the financial industry and sparking debates across economic, technological, and regulatory domains. From Bitcoin’s inception in 2009 to the emergence of thousands of alternative cryptocurrencies, the crypto space has grown into a multi-trillion-dollar market, reshaping our understanding of money, investment, and decentralization. This article explores the history, technology, applications, and challenges of cryptocurrency, while also discussing its potential to redefine global finance. A Brief History of Cryptocurrency The journey of cryptocurrency began with the publication of the Bitcoin whitepaper by the pseudonymous c...
...design only. You can just upload home page for now.) • Home page • What We Do – which will change to ‘Get Support’ • About Us • Stroke Information • Support Us • News • Contact Us • Fundraising Events Page • Donate – incorporate donate and donate monthly • Information Pack • Take Part in research and associated pages I have been looking at charity websites I quite like elements of: Basically, looking for clean, clear and modern feeling with the ‘feel’ of Different Strokes. Thoughts on re-design. The main aim with the refresh is to modernise and freshen up the website and make it as user friendly as possible. So Mobile friendly and accessibility to be...
I'm looking for a talented web designer to create a single page for my website. The specifics of the project will be discussed further, but the ideal freelancer should have a strong portfolio showcasing their design skills and creativity. Result need to be in Figma
I'm seeking a skilled 3D animator to create a captivating animation of a castle ballroom filled with dancers. Key Requirements: - 3D Animation Expertise: The project requires high-level 3D animation skills. - Storybook, Watercolor, Disney-like Visuals: The atmosphere of the ballroom should be magical and reminiscent of a storybook. Think vibrant, watercolor visuals akin to classic Disney films. - Dance Sequence: The animation should depict people dancing in the ballroom. This project does not require any accompanying music or sound, so the focus will be entirely on the visuals. The ideal candidate will be able to create an engaging, high-quality animation that meets these specifications.
I have a total of 35 lakh business leads available for bulk purchase. These leads include contact names and their corresponding email addresses if you interested to Buy Leads Contact us
I need 2000 words related to Counter-Terrorism Policy Impact.
I'm looking for a talented developer to rebuild the frontend of my existing learning app. The new design will be based on a UI configurator, and all changes will need to be extensively documented with clean, maintainable code and thorough unit testing. Key Requirements: - Proficiency in React, Jest, Typescript, Tailwind, HTML, CSS Grids and Flexbox, Drag and Drop, Zustand, and RXJS. - C2 level English for effective communication. - Availability in the UTC +1 / Central European Time (CET) timezone. - A portfolio featuring public repositories built with Typescript, specifically using React, Angular, and Next.js. Focus Areas: - Updating the design to match the new UI configurator. - Improving navigation and layout. - Enhancing interactive elements and responsiven...
I am looking for someone to help promote my GoFundMe and ultimately reach it's goal. This will primarily involve crafting and sending donation appeals to potential donors. Must have Skills: -digital marketing, any marketing. -access to active donors and philanthropists -Campaign goal of 75000 must be reached. No milestones or funds will be advanced. Only upon successful goal of 75000 reached will the payout be released regardless of amount of work put in, it is your expertise I am hiring. The payout will be large for your hard work. But working on contingency is my only option. I have invested to much in fake digital marketers and scammers. Please do not propose if you do not have the experience nor accept this difficult task. If you are co...
I'm looking for a proficient web scraper who can extract specific lists from X/Twitter and use AI to organize the data according to specified parameters. Key Responsibilities: - Scrape lists from X - Use AI to compile and organize the data according to predefined criteria Ideal Skills and Experience: - Proficient in web scraping tools and techniques - Familiarity with AI data compilation methods - Prior experience with social media data extraction - Ability to understand and implement specific data organization parameters
I need an expert to help me with a Wikipedia article I've written. It needs immediate proofreading and editing within 4-5 hours. Please bid only if you can start right away. I plan to publish it myself. Tasks: - Stylistic editing (tone and clarity): I require help to enhance the article's readability and coherence. - Adjustments for notability and neutrality: The article does not fully adhere to Wikipedia's notability and neutrality guidelines, so I need your expertise to make the necessary adjustments. The article is written in English and should take no longer than an hour to complete. Your prompt response and delivery are greatly appreciated.
I'm looking for a proficient web scraper who can extract specific lists from X/Twitter and use AI to organize the data according to specified parameters. Key Responsibilities: - Scrape lists from X - Use AI to compile and organize the data according to predefined criteria Ideal Skills and Experience: - Proficient in web scraping tools and techniques - Familiarity with AI data compilation methods - Prior experience with social media data extraction - Ability to understand and implement specific data organization parameters
