Leaning tower of pisa historyJobs
The creation of a virtual office
ON DANISH: Jeg skal have skrevet 12 forskellige artikler omkring 12 forskellige emner af 300 ord på dansk ON ENGLISH I need 12 different article with 300 words on Danish
Jeg skal ha lavet et database program hvor jeg kan indføre forskellige data hver dag. Skal helst kunne køre som app på både android og ios, ios i første omgang Jeg skal selv kunne skrive og lave nye data der skal indføres. Der skal være et pænt layout og være meget nemt at gå til Der skal være en backend, hvor man selv kan tilføje og rette i de ting der skal indtastes. Der skal ikke være begrænsninger for hvor mange indtastninger man kan lave Alt skal kunne konverteres og udskrives i pdf og excel Der vil være småting der skal ændres og tilføjes løbende, så det skal være en der kan arb på projektet noget tid
I have my campaign
COPY OF AN ECOMMERCE SITE NEED My budget 30 usd
Design A Catalog Of Products (1 Page)
poster for online posts 3 pictures Bold
Har du brug for private eller business lån til forskellige formål? Leder du efter lån til at gennemføre store projekter? Har du søge midler til at betale lån og gæld? Interesserede personer bør kontakte os nu via e-mail for flere detaljer:
Jeg har vedvarende arbejde relateret til vores tidligere projekt ' lots of errors when activating new theme'
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
gwreyejrttjktrhrwhgwgwgwhteajkyrskutskmrsjeagwegyheryhtejhrrahbnwgbqwagvwr vdwsrbhwfsrbfwsarbaenjrh,h,nbcmdagqWREWHTEDJRUHBNGDHBGHDSGSDAGFEDHRFNDGMNFJESAYRSDHGBJFYRSUREDGBAJHTEAJTEKAYHREGWREFEQWGAQWHAFEWAHREAJHYRKUTDSHTR
im looking for an estimate on creating a cad drawing of the ring that i uploaded
Vi søger en organiseret, arbejdsom og veltalende oversætter, som har perfekt grammatik og kan overholde deadlines. Vi er en mode-orienteret e-handel virksomhed fra Danmark, som specialiserer sig i designer solbriller og briller, og vi søger en freelance skribent til at hjælpe os med at oversætte detaljerede beskrivelser af brands/produkter til vores hjemmeside fra engelsk til dansk. Projektinformation: 1. Projektlængden er 5-7 uger (kan forhandles) 2. 30.000 - 50.000 ord 3. Flydende dansk er et krav 4. Evne til at arbejde selvstændigt med en positiv attitude 5. Evne til selv at prioritere arbejdet og overholde deadlines 6. Grundlæggende kendskab til SEO er et plus 7. Stærke computerfærdigheder og stor erfaring med MS W...
I'm looking for someone with a knack for writing and storytelling. The project is somewhat ambiguous at the moment, but it definitely leans towards creative writing. Ideal Skills: - Excellent command of the English language - Strong storytelling ability - Creative thinking Experience: - Previous work in writing and storytelling - Experience in crafting fiction will be a plus Please note that the type of writing needed may be primarily creative and artistic in nature.
...should personalize interactions based on the user’s browsing history (e.g., suggest products or promotions). Collect user information for returning customers (e.g., name, email). Seamless Handover to Live Support (if needed): When the bot reaches the limit of its capabilities or the customer requests it, the chatbot should seamlessly hand over the conversation to a live agent or support team. Multi-platform Integration: Integrate the chatbot on both desktop and mobile versions of the website. Ensure it works across common browsers (Chrome, Firefox, Safari, etc.). Natural Language Processing (NLP): The bot should have basic NLP capabilities to understand and respond to varied user inputs (e.g., "Where’s my order?", "What’s the pric...
More details: Is this project for business or personal use? Personal What information should successful freelancers include in their application? Detailed project proposals How soon do you need your project completed? Within a month
App Concept: Travel Together A mobile application connecting like-minded travelers through curated social events, short trips, and group activities. The app creates a vibrant community of explorers while ensuring safety, compatibility, and seamless travel planning. Key Features 1. User Profiles Travel Preferences: Specify travel interests like adventure, leisure, or cultural trips. Detailed Profiles: Add hobbies, personality traits, and travel styles. Safety Verification: Identity verification badges for trust and authenticity. 2. Event Discovery Curated Events: Browse or create short trips, city tours, hiking adventures, and more. Advanced Filters: Search by location, trip duration, type, and budget. Dynamic Calendar: View upcoming events and RSVP easily. 3. Companion Matching A...
...looking for a talented designer to help refresh the logo for Q’s Harlem Eatz, a food truck inspired by the vibrant culture, history, and flavors of Harlem, New York. The new design should maintain the essence of Harlem’s rich heritage while creating a modern, eye-catching logo that stands out on a food truck and other branding materials. What We’re Looking For: • A fresh and modern take on the current logo. • Incorporation of Harlem’s unique identity (e.g., urban skyline, cultural elements, etc.). • Bold and clean design, suitable for a food truck. • A focus on deliciousness, creativity, and Harlem pride. Current Elements to Consider: • The crown, cityscape, and Statue of Liberty can be reimagine...
Important : Kindly bid if and only if you are willing to take a test assignment. We are looking for a skilled and experienced Figma designer to convert 20 pages of JPG website designs into a fully responsive Figma project. The designs need to be pixel-perfect and optimized for Desktop, Mobile, and Tablet screen sizes. Project Requirements: 1. Figma Expertise: • Convert 20 JPG design files into Figma accurately, maintaining pixel-perfect alignment with the original designs. 2. Responsive Design: • Create layouts optimized for Desktop, Tablet, and Mobile views. • Ensure the designs are fully responsive and adaptable to different screen sizes. 3. Consistency: • Use Figma’s components, auto-layouts, and styles to maintain consistency across the project...
I'm seeking a talented designer to create a modern an...seeking a talented designer to create a modern and sleek t-shirt design for my Army strategic intelligence unit. The design should be able to reflect our mission of supporting service members globally, and it should include the following key elements: - Our unit emblem or insignia - A globe or world map - Depictions of service members Color-wise, I'm leaning towards a bold and vibrant color scheme. The ideal candidate for this project should have experience in graphic design, particularly with creating designs suitable for t-shirts. Understanding of military themes and aesthetics would be a plus. Please ensure the design is oni of high pixel quality, as it will be used for printing on shi...
I'm in need of a high-precision 3D scan of a small plastic object, roughly 2 inches or less. The primary purpose of this scan is for 3D printing, so the model needs to be as accurate as possible. Ideal Skills: - Proficient in 3D scanning technology - Experience in creating models for 3D printing - Attention to detail for high-precision tasks
As an SMB, I am in need of a tailored CRM system that primarily focuses on enhancing our customer relationship management capabilities. This system must also incorporate workforce management features. Key Features: - Comprehensive Contact Management: The system should allow for efficient tracking and managing of customer interactions. - Effective Task Management: The CRM should facilitate the assignment and tracking of tasks within the team. - Resource Management: It should provide tools for managing our resources effectively. - Robust Reporting: The system should be able to generate insightful reports. - KPI Management: The CRM should have capabilities for tracking our key performance indicators. Contact Management Requirements: - Customer Segmentation: The CRM sho...
As a clie...redemptions and more. The software should be compatible for web , making it easily accessible at any time, anywhere. Essential components: • An online booking system that handles real-time scheduling. • A calendar module for managing appointments effectively. • A comprehensive customer database to store contact information, booking history and membership details. Ideal skills and knowledge for the project: • Experience with web and mobile app development. • Understanding of data management for implementing a customer database. • Experience in integrating a real-time scheduling system and other desired functionalities. I welcome any freelancer who has a knack for developing intuitive, user-friendly applications that streamline p...
I am looking to build a comprehensive website for my weight loss clinic. The primary goal of this site is to facilitate online appointment booking. Key Features: - A robust online appointment booking system - Patient intake forms that can be completed online Skills and Experience Required: - Proficient in web development with experience in building healthcare-related websites - Familiar with creating secure online forms for sensitive information - Knowledgeable in implementing a user-friendly interface for convenience and accessibility The patient intake forms will need to collect: - Medical history - Contact information - Some additional criteria (which I can provide) The ideal freelancer for this project should be able to create a site that's not only functional bu...
...to list their vehicles, allowing users to book cars from a multitude of agencies, much like the service provided by Getaround. Key Features: - User Reviews and Ratings: The app should have a system that allows users to review and rate cars and their rental experiences. - Booking Management: An efficient booking system is crucial. This should include features for booking confirmation, cancellation, and modification. - GPS Tracking of Cars: The app should integrate GPS tracking for real-time monitoring of the rented cars. User Management: The application will require a comprehensive user authentication and profile management system. Users should be able to create accounts, manage their profiles, and track their rental history. Ideal Skills and Experience: - ...
You have a pre-built java vaadin saas platform? I'm looking for an experienced developer who can work with a pre-built Java Vaadin SaaS platform. The key tasks will involve extending the platform to meet our specific requirements, as well as incorporating our branding g...pre-built java vaadin saas platform? I'm looking for an experienced developer who can work with a pre-built Java Vaadin SaaS platform. The key tasks will involve extending the platform to meet our specific requirements, as well as incorporating our branding guidelines into the design. Ideal Skills: - Proficiency in Java and Vaadin - Experience with SaaS platform development - Strong understanding of UI/UX, with the ability to adapt to branding guidelines - Prior experience with platform customization a...
This project delves into the fascinating intersection of behavioral finance and data science. We aim to analyze ptivided data through the lens of investor psychology, identifying behavioral biases and sentiment drivers that influence market trends. Using R and statistical modeling, we will examine historical market data, news sentiment, and social media trends to develop predictive models of market movements. This project offers a unique opportunity to contribute to a cutting-edge research initiative with real-world applications in investment strategy and risk management. Key Deliverables: Quantitative analysis of market data and investor behavior. Development of predictive models incorporating behavioral finance insights. Comprehensive report with data...
I'm looking ...A system for product reviews is essential to build trust and community amongst buyers. Navigation Features: - Category Filters: Customers should be able to filter products by categories. - Search Bar: An efficient search bar to help users find specific products quickly. - Product Recommendations: The site should intelligently recommend products to users based on their browsing and purchasing history. The ideal freelancer for this project should have a strong portfolio in ecommerce website design, particularly for physical products. Experience with implementing user-friendly navigation tools and interactive features like product reviews and recommendations is a must. I would appreciate designers who can create visually appealing sites that are also functional a...
I'm seeking a minimalist style WebM animation. The sequence should involve splashed poker chip stacks organizing neatly, then toppling over, before the loop restarts. The color scheme is bright and...minimalist style WebM animation. The sequence should involve splashed poker chip stacks organizing neatly, then toppling over, before the loop restarts. The color scheme is bright and vivid, so it should pop and be visually engaging. Key Requirements: - Animation should have a minimalist design - Use of a bright and vivid color palette - Customization of the poker chips with my provided logo in the middle area Ideal Skills and Experience: - Proficient in creating WebM animations - Strong understanding of minimalist design principles - Experience with logo and patte...
My Digital Ocean droplet, which hosts a web application, has stopped responding after a restart. I suspect a network issue. It’s crucial to get this fixed ASAP. Ideal Skills: - Experience with Digital Ocean droplets - Networking troubleshooting - Web application hosting - Server management Please reach out if you can assist. Bid if you can start working immediately
...AI-based early detection of congenital heart defects (CHDs) using a 12,000-labeled echocardiogram dataset. I need an experienced freelancer to completely build and train models using Convolutional Neural Networks (CNNs) and Generative Adversarial Networks (GANs) to achieve accurate and reliable results. The task involves: Preprocessing: Augmentation and cleaning of the dataset. Model Development: Building and training a GAN-CNN hybrid model for CHD detection. Validation: Testing and validating the model to generate results, including metrics like accuracy, sensitivity, and specificity. Deliverables: Fully functional code (Python/TensorFlow/Keras, Google Colab preferred). Final results and visualizations (accuracy metrics, confusion matrix, etc.). Proper documentation ...
I need a skilled PHP developer to integrate a comprehensive billing feature into my LIS portal. The key components of this project include: - Invoicing: The system should support both one-time and recurring invoices. You will need to create customizable invoice templates. - Billing History: This should be displayed in a simple list view that allows users to easily track their past transactions. Ideal skills for this project include a strong background in PHP, experience with billing and invoicing systems, and a good understanding of user interface design to create a clear and easy-to-navigate billing history view. Please provide examples of similar projects you've completed in your bid.
We need another sequence for the wedding opener. This time, it's about a chat history on WhatsApp and Instagram. The messages should appear in the respective platform designs of Whatsapp and Instagram. I am happy to provide you with: A script with the messages (5 chat sequences) A template from Envato Market (if needed) Would you like to take on this project? Looking forward to hearing from you. Best regards, Tom
...System (LMS) specifically for Home loans and Loan Against Property (LAP). The systems need to be built for both web and mobile platforms. 1. Executive Summary The purpose of this project is to design and implement a robust and scalable Loan Origination System (LOS) and Loan Management System (LMS) tailored for Home Loans (HL) and Loan Against Property (LAP). The LOS will streamline the loan origination process from application to approval, while the LMS will handle post-disbursement activities such as repayment tracking, collections, and customer servicing. 2. Business Objectives Automate and digitize the end-to-end lifecycle of HL and LAP. Ensure seamless integration between LOS and LMS for better operational efficiency. Enhance customer experience with faster processin...
Statement Of Work User App: - Login o Login with Mobile Number: Users can enter their registered mobile number to access the app. Login with OTP: o Users receive a One-Time Password (OTP) on their registered mobile number. Signup o Signup with Personal Details Users can create a new account by providing o Name o Email address o Mobile number o Password Home Page o Users can view Banners o Users can view Sliders View Subscription Plan o A list of available Subscription plan is displayed, categorized by: Duration (e.g.; 1-month,3-month,6-month, 1-Year) Select Packages o Shortlist Favorite Packages Users can add plans to a “Favorites” list for quick future purchase. o Choose a Package Once finalized, users can select a plan to proceed with pur...
I am seeking a talented creative writer with a knack for crafting captivating romance narratives. Your primary task will be to create engaging storylines that resonate with an adult audience. Ideal candidates should have: - Proven experience in creative storytelling, particularly in the romance genre. - Excellent command over the written word, with a flair for crafting compelling narrati...resonate with an adult audience. Ideal candidates should have: - Proven experience in creative storytelling, particularly in the romance genre. - Excellent command over the written word, with a flair for crafting compelling narratives. - Ability to understand and cater to an adult audience. Your creative storytelling will not only entertain but also draw readers into the beautiful complexities of...
I am in need of a talented copywriter who can help me craft compelling product descriptions aimed at increasing sales. The target audience for these descriptions is the general consumer market, so the copy will need to be accessible, engaging, and persuasive to a wide array of potential customers. Ideal Skills and Experience: - Proven experience in copywriting, particularly in crafting product descriptions - Strong understanding of sales-oriented copy - Ability to write for a general consumer audience - Creativity and ability to think outside the box - Excellent command of the English language
I'm seeking a skilled developer with a strong background in artificial intelligence, facial recognition, and augmented reality technologies to create a unique mobile application. The app should analyze users' facial features and offer personalized recommendations to e...system for facial feature evaluation. 3- An appealing and easy-to-navigate user interface. Technical Skills Required: 1- Exceptional UI/UX design capabilities. 2- Profound knowledge in applying facial recognition and augmented reality technologies. Ideal bidders should have a demonstrated history of developing similar applications, with a portfolio showcasing previous work in AI, AR, and facial recognition. Your ability to create a visually appealing and user-friendly interface will be crucial to t...
